UniProt ID | SMCO4_HUMAN | |
---|---|---|
UniProt AC | Q9NRQ5 | |
Protein Name | Single-pass membrane and coiled-coil domain-containing protein 4 | |
Gene Name | SMCO4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 59 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | QEARQQITTVVLPTL HHHHHHHHHHHHHHH | 22210691 | ||
32 | Phosphorylation | EARQQITTVVLPTLA HHHHHHHHHHHHHHH | 22210691 | ||
53 | Phosphorylation | VVFVYVATRPTITE- HHHHHHHHCCCCCC- | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMCO4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMCO4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMCO4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
K1C40_HUMAN | KRT40 | physical | 25416956 | |
KASH5_HUMAN | CCDC155 | physical | 25416956 | |
SYNE4_HUMAN | SYNE4 | physical | 25416956 | |
KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
BNI3L_HUMAN | BNIP3L | physical | 21516116 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...