| UniProt ID | SMCO4_HUMAN | |
|---|---|---|
| UniProt AC | Q9NRQ5 | |
| Protein Name | Single-pass membrane and coiled-coil domain-containing protein 4 | |
| Gene Name | SMCO4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 59 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | Phosphorylation | QEARQQITTVVLPTL HHHHHHHHHHHHHHH | 22210691 | ||
| 32 | Phosphorylation | EARQQITTVVLPTLA HHHHHHHHHHHHHHH | 22210691 | ||
| 53 | Phosphorylation | VVFVYVATRPTITE- HHHHHHHHCCCCCC- | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMCO4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMCO4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMCO4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| K1C40_HUMAN | KRT40 | physical | 25416956 | |
| KASH5_HUMAN | CCDC155 | physical | 25416956 | |
| SYNE4_HUMAN | SYNE4 | physical | 25416956 | |
| KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| BNI3L_HUMAN | BNIP3L | physical | 21516116 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...