| UniProt ID | SLX1_SCHPO | |
|---|---|---|
| UniProt AC | Q9P7M3 | |
| Protein Name | Structure-specific endonuclease subunit slx1 {ECO:0000255|HAMAP-Rule:MF_03100, ECO:0000303|PubMed:14528010, ECO:0000312|EMBL:CAB76036.1} | |
| Gene Name | slx1 {ECO:0000312|EMBL:CAB76036.1} | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 271 | |
| Subcellular Localization | Nucleus, nucleolus . Associates with chromatin at rDNA repeat protrusions. | |
| Protein Description | Catalytic subunit of the slx1-slx4 structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA. Has a preference for stem-loop (SL) and splayed arm Y structures. Introduces a single-strand cut in duplex DNA on the 3' side of a double-strand/single-strand junction with respect to the single-strand moving 3' to 5' away from the junction. Plays a critical role in maintaining the integrity of the ribosomal DNA (rDNA) loci, where it has a role in re-starting stalled replication forks. The complex initiates homologous recombination (HR) events, used to maintain rDNA copy number, in the rDNA repeats that are processed by a mechanism that requires rad22, but not rhp51. It is also required for suppression of methyl methanesulfonate (MMS) and UV-C irradiation hypersensitivity of the structural maintenance of chromosome (SMC) protein mutant, smc6-74, by overexpression of brc1. Has Holliday junction resolvase activity in vitro.. | |
| Protein Sequence | MDLCNFYCCYLLKSNRTQSSGAVYIGSTPDPPRRLRQHNGEIVGGASKTKHGRPWSISCLVYGFPNKVSALKFEWNWQNLGISRYTKDCDFRSKKQKTIMYCLKGLKHLVDSDTWRRWPLNITFLNKTAFSKWNQLGKTYGNINVYFDEEWLNGFHEKVIQKTYDHKLCLRKTISEPVKCNLCYECIESDELRANCPFTDCNSINHLTCLASSFLTEECQVLPIEGMCTKCKRVLRWREFLSTVFTTSLETDERDFESENRIEIIDLELEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SLX1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SLX1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SLX1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SLX1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HUS2_SCHPO | rqh1 | genetic | 14528010 | |
| SLX4_SCHPO | slx4 | physical | 14528010 | |
| DNM1_SCHPO | dnm1 | genetic | 18818364 | |
| YBPD_SCHPO | SPBC16H5.13 | genetic | 18818364 | |
| BDC1_SCHPO | bdc1 | genetic | 18818364 | |
| ASK1_SCHPO | ask1 | genetic | 18818364 | |
| HIR1_SCHPO | hip1 | genetic | 18818364 | |
| RL16B_SCHPO | rpl1601 | genetic | 18818364 | |
| SWC5_SCHPO | swc5 | genetic | 18818364 | |
| VPH2_SCHPO | vph2 | genetic | 18818364 | |
| SLX4_SCHPO | slx4 | physical | 26787556 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
