SLD7_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SLD7_YEAST
• UniProt AC: Q08457
• Protein Name: Mitochondrial morphogenesis protein SLD7
• Gene Name: SLD7
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 257
• Subcellular Localization: Nucleus . Cytoplasm, cytoskeleton, spindle pole .
• Protein Description: Required for the proper function of SLD3 at the initiation of DNA replication. Binds to SLD3 and reduces its affinity for CDC45, a component of the replication fork. Required for mitochondrial morphology..
• Protein Sequence: MSRKLCTLNFTLSGKQGSLVIRDIQLWSNRPTASKSTSELRGQFIQYVDLAKLPLWVRSTNMNTYRCYSTSATAQAYFKSKLRNANRGIVIELFDKVDQRSQEPAYLIIFRENTELNCFQVDLTMKHEFDGQVTKLKQDIGKTRASVSKEGSIDIIIQQSQQRKIGTKTEVYRNVHINDKRLQFNETLSKLILGGLRLRGISNSITDYQKLYKITFDAAEFTHRDELKRISMGSGEEVSFESLQETVETLLKLFTKS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SLD7_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SLD7_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SLD7_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SLD7_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SLD3_YEAST	SLD3	physical	21487389
SLD3_YEAST	SLD3	genetic	21487389
CDC45_YEAST	CDC45	genetic	21487389
DPB11_YEAST	DPB11	genetic	21487389
SML1_YEAST	SML1	genetic	22081107
RAD53_YEAST	RAD53	genetic	22279048

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.