UniProt ID | SIRT2_DROME | |
---|---|---|
UniProt AC | Q9I7I7 | |
Protein Name | NAD-dependent protein deacetylase Sirt2 | |
Gene Name | Sirt2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 355 | |
Subcellular Localization | ||
Protein Description | NAD-dependent protein deacetylase (By similarity). May be involved in the regulation of life span.. | |
Protein Sequence | MDKVRRFFANTLHLGGSSDAKEEVKVEKVIPDLSFDGFAEHWRVHGFRKIVTMVGAGISTSAGIPDFRSPGSGLYSNLKKYELPHPTAIFDLDYFEKNPAPFFALAKELYPGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKCRKEYDMDWMKAEIFADRLPKCQKCQGVVKPDIVFFGENLPKRFYSSPEEDFQDCDLLIIMGTSLEVQPFASLVWRPGPRCIRLLINRDAVGQASCVLFMDPNTRSLLFDKPNNTRDVAFLGDCDAGVMALAKALGWDQELQQLITSERKKLSGSQNSEELQQGKEKPQSDPDKMTSGDRDKKDASL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | NTLHLGGSSDAKEEV HHCCCCCCCCHHHHC | 24.20 | 27794539 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIRT2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIRT2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIRT2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VTU3_DROME | Vm34Ca | physical | 14605208 | |
VTU2_DROME | Vm26Ab | physical | 15575970 | |
GUS_DROME | gus | physical | 15575970 | |
PGAM5_DROME | Pgam5 | physical | 15575970 | |
PP12_DROME | Pp1-87B | physical | 15575970 | |
CEG1A_DROME | CenG1A | physical | 15575970 | |
DIMM_DROME | dimm | physical | 15575970 | |
MED15_DROME | MED15 | physical | 15575970 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...