| UniProt ID | SIRT2_DROME | |
|---|---|---|
| UniProt AC | Q9I7I7 | |
| Protein Name | NAD-dependent protein deacetylase Sirt2 | |
| Gene Name | Sirt2 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 355 | |
| Subcellular Localization | ||
| Protein Description | NAD-dependent protein deacetylase (By similarity). May be involved in the regulation of life span.. | |
| Protein Sequence | MDKVRRFFANTLHLGGSSDAKEEVKVEKVIPDLSFDGFAEHWRVHGFRKIVTMVGAGISTSAGIPDFRSPGSGLYSNLKKYELPHPTAIFDLDYFEKNPAPFFALAKELYPGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKCRKEYDMDWMKAEIFADRLPKCQKCQGVVKPDIVFFGENLPKRFYSSPEEDFQDCDLLIIMGTSLEVQPFASLVWRPGPRCIRLLINRDAVGQASCVLFMDPNTRSLLFDKPNNTRDVAFLGDCDAGVMALAKALGWDQELQQLITSERKKLSGSQNSEELQQGKEKPQSDPDKMTSGDRDKKDASL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | NTLHLGGSSDAKEEV HHCCCCCCCCHHHHC | 24.20 | 27794539 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SIRT2_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SIRT2_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SIRT2_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VTU3_DROME | Vm34Ca | physical | 14605208 | |
| VTU2_DROME | Vm26Ab | physical | 15575970 | |
| GUS_DROME | gus | physical | 15575970 | |
| PGAM5_DROME | Pgam5 | physical | 15575970 | |
| PP12_DROME | Pp1-87B | physical | 15575970 | |
| CEG1A_DROME | CenG1A | physical | 15575970 | |
| DIMM_DROME | dimm | physical | 15575970 | |
| MED15_DROME | MED15 | physical | 15575970 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...