dbPTM

SH21B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SH21B_HUMAN
UniProt AC	O14796
Protein Name	SH2 domain-containing protein 1B
Gene Name	SH2D1B
Organism	Homo sapiens (Human).
Sequence Length	132
Subcellular Localization
Protein Description	Cytoplasmic adapter regulating receptors of the signaling lymphocytic activation molecule (SLAM) family such as CD84, SLAMF1, LY9 and CD244. [PubMed: 11689425 In SLAM signaling seems to cooperate with SH2D1A/SAP. Plays a role in regulation of effector functions of natural killer (NK) cells by controlling signal transduction through CD244/2B4 without effecting its tyrosine phosphorylation; downstream signaling involves PLCG1 and ERK activation]
Protein Sequence	MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
67	Phosphorylation	HGYYRIQTAEGSPKQ CCEEEEEECCCCHHH	25.06	27080861
71	Phosphorylation	RIQTAEGSPKQVFPS EEEECCCCHHHHCHH	22.04	27080861
104	Phosphorylation	LLKPIKRTSPSLRWR EECCCCCCCCCCCCC	39.73	29449344
105	Phosphorylation	LKPIKRTSPSLRWRG ECCCCCCCCCCCCCC	19.27	29449344
107	Phosphorylation	PIKRTSPSLRWRGLK CCCCCCCCCCCCCEE	30.27	29449344
127	Phosphorylation	FVNSNSDYVDVLP-- HHCCCCCCEECCC--	9.81	24687958

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SH21B_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SH21B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SH21B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SLAF1_HUMAN	SLAMF1	physical	11689425
A4_HUMAN	APP	physical	21832049
ERBB2_HUMAN	ERBB2	physical	16273093
STAT4_HUMAN	STAT4	physical	25814554
OLIG1_HUMAN	OLIG1	physical	25814554
FAK1_HUMAN	PTK2	physical	25814554

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SH21B_HUMAN

Related Literatures of Post-Translational Modification