UniProt ID | SFRP2_HUMAN | |
---|---|---|
UniProt AC | Q96HF1 | |
Protein Name | Secreted frizzled-related protein 2 | |
Gene Name | SFRP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 295 | |
Subcellular Localization | Secreted. | |
Protein Description | Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP2 may be important for eye retinal development and for myogenesis.. | |
Protein Sequence | MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | LLLLFLASHCCLGSA HHHHHHHHHHHHHCH | 21.14 | 22210691 | |
220 | Phosphorylation | ILETKSKTIYKLNGV EEEECCCEEEECCCC | 36.31 | 24719451 | |
222 | Phosphorylation | ETKSKTIYKLNGVSE EECCCEEEECCCCCH | 18.04 | - | |
235 | Phosphorylation | SERDLKKSVLWLKDS CHHHHHHHHHHHHHH | 22.36 | - | |
287 | Phosphorylation | QREFKRISRSIRKLQ HHHHHHHHHHHHHHC | 24.82 | 23927012 | |
289 | Phosphorylation | EFKRISRSIRKLQC- HHHHHHHHHHHHCC- | 21.69 | 23927012 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SFRP2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SFRP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SFRP2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
WNT4_HUMAN | WNT4 | physical | 9853965 | |
ARMC8_HUMAN | ARMC8 | physical | 26186194 | |
MAEA_HUMAN | MAEA | physical | 26186194 | |
MKLN1_HUMAN | MKLN1 | physical | 26186194 | |
RMD5A_HUMAN | RMND5A | physical | 26186194 | |
RANB9_HUMAN | RANBP9 | physical | 26186194 | |
ARMC8_HUMAN | ARMC8 | physical | 28514442 | |
MKLN1_HUMAN | MKLN1 | physical | 28514442 | |
SFRP5_HUMAN | SFRP5 | physical | 17123353 | |
PP1G_HUMAN | PPP1CC | physical | 17123353 | |
PP1A_HUMAN | PPP1CA | physical | 17123353 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-289, AND MASSSPECTROMETRY. |