| UniProt ID | SFRP2_HUMAN | |
|---|---|---|
| UniProt AC | Q96HF1 | |
| Protein Name | Secreted frizzled-related protein 2 | |
| Gene Name | SFRP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 295 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP2 may be important for eye retinal development and for myogenesis.. | |
| Protein Sequence | MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Phosphorylation | LLLLFLASHCCLGSA HHHHHHHHHHHHHCH | 21.14 | 22210691 | |
| 220 | Phosphorylation | ILETKSKTIYKLNGV EEEECCCEEEECCCC | 36.31 | 24719451 | |
| 222 | Phosphorylation | ETKSKTIYKLNGVSE EECCCEEEECCCCCH | 18.04 | - | |
| 235 | Phosphorylation | SERDLKKSVLWLKDS CHHHHHHHHHHHHHH | 22.36 | - | |
| 287 | Phosphorylation | QREFKRISRSIRKLQ HHHHHHHHHHHHHHC | 24.82 | 23927012 | |
| 289 | Phosphorylation | EFKRISRSIRKLQC- HHHHHHHHHHHHCC- | 21.69 | 23927012 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SFRP2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SFRP2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SFRP2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| WNT4_HUMAN | WNT4 | physical | 9853965 | |
| ARMC8_HUMAN | ARMC8 | physical | 26186194 | |
| MAEA_HUMAN | MAEA | physical | 26186194 | |
| MKLN1_HUMAN | MKLN1 | physical | 26186194 | |
| RMD5A_HUMAN | RMND5A | physical | 26186194 | |
| RANB9_HUMAN | RANBP9 | physical | 26186194 | |
| ARMC8_HUMAN | ARMC8 | physical | 28514442 | |
| MKLN1_HUMAN | MKLN1 | physical | 28514442 | |
| SFRP5_HUMAN | SFRP5 | physical | 17123353 | |
| PP1G_HUMAN | PPP1CC | physical | 17123353 | |
| PP1A_HUMAN | PPP1CA | physical | 17123353 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-289, AND MASSSPECTROMETRY. | |
