UniProt ID | SEN15_HUMAN | |
---|---|---|
UniProt AC | Q8WW01 | |
Protein Name | tRNA-splicing endonuclease subunit Sen15 | |
Gene Name | TSEN15 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 171 | |
Subcellular Localization | Nucleus . Nucleus, nucleolus . May be transiently localized in the nucleolus. | |
Protein Description | Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. [PubMed: 15109492] | |
Protein Sequence | MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MEERGDSEPTPGCS -CCCCCCCCCCCCCC | 48.58 | 21815630 | |
10 | Phosphorylation | ERGDSEPTPGCSGLG CCCCCCCCCCCCCCC | 28.41 | 25159151 | |
14 | Phosphorylation | SEPTPGCSGLGPGGV CCCCCCCCCCCCCCC | 42.86 | 21406692 | |
42 | Phosphorylation | PEDAWMGTHPKYLEM CCCCCCCCCHHHHHH | 20.92 | 28857561 | |
168 | Phosphorylation | LPDPQNISLRR---- CCCCCCCCCCC---- | 24.31 | 25558065 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEN15_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEN15_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
10 | Phosphorylation | 19 (9) | G ⇒ D | rs2274432 |
| 25673412 28448500 28443625 18391951 |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CLP1_HUMAN | CLP1 | physical | 15109492 | |
SEN2_HUMAN | TSEN2 | physical | 15109492 | |
SEN54_HUMAN | TSEN54 | physical | 15109492 | |
SEN34_HUMAN | TSEN34 | physical | 15109492 | |
SEN2_HUMAN | TSEN2 | physical | 28514442 | |
MINK1_HUMAN | MINK1 | physical | 28514442 | |
MOG1_HUMAN | RANGRF | physical | 28514442 | |
SEN34_HUMAN | TSEN34 | physical | 28514442 | |
SEN54_HUMAN | TSEN54 | physical | 28514442 | |
CLP1_HUMAN | CLP1 | physical | 28514442 | |
UBP7_HUMAN | USP7 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...