SEN15_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SEN15_HUMAN
• UniProt AC: Q8WW01
• Protein Name: tRNA-splicing endonuclease subunit Sen15
• Gene Name: TSEN15
• Organism: Homo sapiens (Human).
• Sequence Length: 171
• Subcellular Localization: Nucleus . Nucleus, nucleolus . May be transiently localized in the nucleolus.
• Protein Description: Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. [PubMed: 15109492]
• Protein Sequence: MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MEERGDSEPTPGCS -CCCCCCCCCCCCCC	48.58	21815630
10	Phosphorylation	ERGDSEPTPGCSGLG CCCCCCCCCCCCCCC	28.41	25159151
14	Phosphorylation	SEPTPGCSGLGPGGV CCCCCCCCCCCCCCC	42.86	21406692
42	Phosphorylation	PEDAWMGTHPKYLEM CCCCCCCCCHHHHHH	20.92	28857561
168	Phosphorylation	LPDPQNISLRR---- CCCCCCCCCCC----	24.31	25558065

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SEN15_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SEN15_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
10	Phosphorylation	19 (9)	G ⇒ D	rs2274432	Waist circumference adjusted for body mass index Waist circumference adjusted for BMI in inactive individuals Waist circumference adjusted for BMI (joint analysis main effects and physical activity interaction) Waist circumference adjusted for BMI (joint analysis main effects and smoking interaction)	25673412 28448500 28443625 18391951

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CLP1_HUMAN	CLP1	physical	15109492
SEN2_HUMAN	TSEN2	physical	15109492
SEN54_HUMAN	TSEN54	physical	15109492
SEN34_HUMAN	TSEN34	physical	15109492
SEN2_HUMAN	TSEN2	physical	28514442
MINK1_HUMAN	MINK1	physical	28514442
MOG1_HUMAN	RANGRF	physical	28514442
SEN34_HUMAN	TSEN34	physical	28514442
SEN54_HUMAN	TSEN54	physical	28514442
CLP1_HUMAN	CLP1	physical	28514442
UBP7_HUMAN	USP7	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.