UniProt ID | SCW_DROME | |
---|---|---|
UniProt AC | P54631 | |
Protein Name | Protein screw | |
Gene Name | scw | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 400 | |
Subcellular Localization | Secreted. | |
Protein Description | Part of the signal that specifies dorsal cell fates in the embryo. Acts together with dpp.. | |
Protein Sequence | MLNVFFLTSLFYAASATTYVTTNNHIEMPIYQKRPLSEQMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
165 | N-linked_Glycosylation | SLVDRRANFTVSVYR CHHCCCCCEEEEEEE | 31.17 | - | |
189 | N-linked_Glycosylation | YRILGSVNTTSSQRG EEEEEECCCCCCCCC | 39.06 | - | |
201 | N-linked_Glycosylation | QRGWLEFNLTDTLRY CCCEEEEEHHHHHHH | 32.43 | - | |
304 | N-linked_Glycosylation | PQSCERLNFTVDFKE CCCCCCCCEEEEHHH | 36.44 | - | |
342 | N-linked_Glycosylation | FPLGTKMNATNHAIV CCCCCCCCHHCHHHH | 45.21 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SCW_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SCW_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SCW_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SOG_DROME | sog | genetic | 9827802 | |
TSG_DROME | tsg | physical | 15797386 | |
SOG_DROME | sog | physical | 15797386 | |
DECA_DROME | dpp | physical | 15797386 | |
DECA_DROME | dpp | physical | 24560644 | |
DECA_DROME | dpp | physical | 27578781 | |
SCW_DROME | scw | physical | 24560644 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...