SCW_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SCW_DROME
• UniProt AC: P54631
• Protein Name: Protein screw
• Gene Name: scw
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 400
• Subcellular Localization: Secreted.
• Protein Description: Part of the signal that specifies dorsal cell fates in the embryo. Acts together with dpp..
• Protein Sequence: MLNVFFLTSLFYAASATTYVTTNNHIEMPIYQKRPLSEQMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQPHLPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
165	N-linked_Glycosylation	SLVDRRANFTVSVYR CHHCCCCCEEEEEEE	31.17	-
189	N-linked_Glycosylation	YRILGSVNTTSSQRG EEEEEECCCCCCCCC	39.06	-
201	N-linked_Glycosylation	QRGWLEFNLTDTLRY CCCEEEEEHHHHHHH	32.43	-
304	N-linked_Glycosylation	PQSCERLNFTVDFKE CCCCCCCCEEEEHHH	36.44	-
342	N-linked_Glycosylation	FPLGTKMNATNHAIV CCCCCCCCHHCHHHH	45.21	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SCW_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SCW_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SCW_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SOG_DROME	sog	genetic	9827802
TSG_DROME	tsg	physical	15797386
SOG_DROME	sog	physical	15797386
DECA_DROME	dpp	physical	15797386
DECA_DROME	dpp	physical	24560644
DECA_DROME	dpp	physical	27578781
SCW_DROME	scw	physical	24560644

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.