SAR1B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SAR1B_ARATH
• UniProt AC: Q01474
• Protein Name: GTP-binding protein SAR1B
• Gene Name: SAR1B
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 193
• Subcellular Localization: Endoplasmic reticulum. Golgi apparatus.
• Protein Description: Involved in transport from the endoplasmic reticulum to the Golgi apparatus..
• Protein Sequence: MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALATVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYIN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
56	Phosphorylation	QPTQHPTSEELSIGK CCCCCCCCCCCCCCE	33.26	19880383
60	Phosphorylation	HPTSEELSIGKIKFK CCCCCCCCCCEEEEE	32.35	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SAR1B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SAR1B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SAR1B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PR1F4_ARATH	PRA1.F4	physical	21798944
PR1F3_ARATH	PRA8	physical	21798944
NAC89_ARATH	NAC089	physical	21798944
PR1B6_ARATH	PRA1.B6	physical	21798944
PR1A1_ARATH	PRA1.A1	physical	21798944
CSN5B_ARATH	CSN5B	physical	21798944
PR1B5_ARATH	PRA1.B5	physical	21798944
RTNLL_ARATH	AT3G54120	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.