PR1A1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PR1A1_ARATH
• UniProt AC: Q9LZM7
• Protein Name: PRA1 family protein A1
• Gene Name: PRA1A1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 209
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments..
• Protein Sequence: MDWGNVTVDDLFDALREVDWSSPPRPPSEFFSRFTVPKSVPKWDSRLKCNLYYYRTNYFIMIVVILGLGVLTRPLAIFAALLTALSLAFLNDSFAGSFSEKATRTVRRFSPQLAAKMRPPLTPVTRGRPSSKRAIHVCGQPRWVFVLTCSLVSFALWYISSGLLRVSVALLIAHLATILHASLRTPNLKARFNTFREEFRAVWRNYSEI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
32	Phosphorylation	RPPSEFFSRFTVPKS CCCHHHHHCCCCCCC	31.63	28011693
35	Phosphorylation	SEFFSRFTVPKSVPK HHHHHCCCCCCCCCC	34.49	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PR1A1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PR1A1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PR1A1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.