UniProt ID | PR1F4_ARATH | |
---|---|---|
UniProt AC | Q9LIC7 | |
Protein Name | PRA1 family protein F4 | |
Gene Name | PRA1F4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 188 | |
Subcellular Localization |
Endosome membrane Multi-pass membrane protein . |
|
Protein Description | May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments.. | |
Protein Sequence | MANNDEITTSSHASPAVNHESISRAKQRIKDGLATRRSWRVMFDLHSTGLPHGVSDVFSRIKTNLAYFRSNYAIVILNVIFFSLIWHPTSLIVFTGLVFLWIFLYFLRDVPLKVFRFQIDDRAVLIGLSVITIVLLLLTNATFNIVAALMAGAVLVLIHAVIRKTDDLFLDEEAATTETSGLTSHPSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PR1F4_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PR1F4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PR1F4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PR1F4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NAC89_ARATH | NAC089 | physical | 21798944 | |
SAR1A_ARATH | SAR2 | physical | 21798944 | |
XB35_ARATH | XBAT35 | physical | 21798944 | |
ARAD2_ARATH | ARAD2 | physical | 24833385 | |
HHP2_ARATH | HHP2 | physical | 24833385 | |
COPT5_ARATH | COPT5 | physical | 24833385 | |
CNIH1_ARATH | AT3G12180 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...