| UniProt ID | COPT5_ARATH | |
|---|---|---|
| UniProt AC | Q93VM8 | |
| Protein Name | Copper transporter 5 | |
| Gene Name | COPT5 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 146 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | Involved in the transport of copper.. | |
| Protein Sequence | MMHMTFYWGIKATILFDFWKTDSWLSYILTLIACFVFSAFYQYLENRRIQFKSLSSSRRAPPPPRSSSGVSAPLIPKSGTRSAAKAASVLLFGVNAAIGYLLMLAAMSFNGGVFIAIVVGLTAGYAVFRSDDGGADTATDDPCPCA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 66 | Phosphorylation | RAPPPPRSSSGVSAP CCCCCCCCCCCCCCC | 34.33 | 30407730 | |
| 67 | Phosphorylation | APPPPRSSSGVSAPL CCCCCCCCCCCCCCC | 32.18 | 30407730 | |
| 68 | Phosphorylation | PPPPRSSSGVSAPLI CCCCCCCCCCCCCCC | 44.45 | 30291188 | |
| 71 | Phosphorylation | PRSSSGVSAPLIPKS CCCCCCCCCCCCCCC | 27.91 | 30407730 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COPT5_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COPT5_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COPT5_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBC34_ARATH | UBC34 | physical | 24833385 | |
| CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
| CP21D_ARATH | AT3G66654 | physical | 24833385 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...