COPT5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: COPT5_ARATH
• UniProt AC: Q93VM8
• Protein Name: Copper transporter 5
• Gene Name: COPT5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 146
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Involved in the transport of copper..
• Protein Sequence: MMHMTFYWGIKATILFDFWKTDSWLSYILTLIACFVFSAFYQYLENRRIQFKSLSSSRRAPPPPRSSSGVSAPLIPKSGTRSAAKAASVLLFGVNAAIGYLLMLAAMSFNGGVFIAIVVGLTAGYAVFRSDDGGADTATDDPCPCA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
66	Phosphorylation	RAPPPPRSSSGVSAP CCCCCCCCCCCCCCC	34.33	30407730
67	Phosphorylation	APPPPRSSSGVSAPL CCCCCCCCCCCCCCC	32.18	30407730
68	Phosphorylation	PPPPRSSSGVSAPLI CCCCCCCCCCCCCCC	44.45	30291188
71	Phosphorylation	PRSSSGVSAPLIPKS CCCCCCCCCCCCCCC	27.91	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of COPT5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of COPT5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of COPT5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC34_ARATH	UBC34	physical	24833385
CNIH1_ARATH	AT3G12180	physical	24833385
CP21D_ARATH	AT3G66654	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.