dbPTM

PR1F3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PR1F3_ARATH
UniProt AC	Q9LIC6
Protein Name	PRA1 family protein F3 {ECO:0000303\|PubMed:18583532}
Gene Name	PRA1F3 {ECO:0000303\|PubMed:18583532}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	188
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein . Membrane Multi-pass membrane protein . Cytoplasm .
Protein Description	May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments..
Protein Sequence	MTNYGAIPTSSHASPLVDVESLSRAKHRIKAGLATRRAWRVMFDFHSMGLPHGVSDAFTRIKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVVVWIFLYFLRDEPIKLFRFQIDDRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHSVVRKTEDLFLDEEAATTETSGLTSYPST

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
21	Phosphorylation	SPLVDVESLSRAKHR CCCCCHHHHHHHHHH	31.34	30407730
23	Phosphorylation	LVDVESLSRAKHRIK CCCHHHHHHHHHHHH	39.20	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PR1F3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PR1F3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PR1F3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FK122_ARATH	AT5G49000	physical	21798944
PPD5_ARATH	AT5G11450	physical	21798944
MCCB_ARATH	MCCB	physical	21798944
RAE1C_ARATH	RAB8A	physical	21798944
PR1F3_ARATH	PRA8	physical	21798944
PPDEX_ARATH	AT4G17486	physical	21798944
VP322_ARATH	SNF7.1	physical	21798944
SAR1A_ARATH	SAR2	physical	21798944
PP372_ARATH	AT5G09450	physical	21798944
KCS1_ARATH	KCS1	physical	24823379
NAC2_ARATH	ATAF1	physical	24823379
DTX6_ARATH	AT2G04100	physical	24823379
LACS8_ARATH	LACS8	physical	24823379
PR1F3_ARATH	PRA8	physical	24823379
RAA1E_ARATH	RABA1e	physical	24823379
PUB35_ARATH	AT4G25160	physical	24823379
UBC34_ARATH	UBC34	physical	24833385

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PR1F3_ARATH

Related Literatures of Post-Translational Modification