SAP1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SAP1_SCHPO
• UniProt AC: P40847
• Protein Name: Switch-activating protein 1
• Gene Name: sap1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 254
• Subcellular Localization: Nucleus .
• Protein Description: Binds to sequences required for mating-type switching. Makes a simultaneous contact with both the alpha and beta domains of the switch-activating site SAS1. Also binds to replication fork barrier 1 (RFB1) located within a 78 base pair sequence near the 3' end of the rRNA coding region. This leads to replication fork blockage. It binds the consensus sequence 5'-TA[AG]GCAGNTN[CT]AACG[AC]G-3'.; Has a role in chromosome organization and integrity where it is involved in chromosome segregation. Has a role in sister chromatid cohesion and condensation..
• Protein Sequence: MEAPKMELKSYKRKNASLSPSSSPAKAQRTHLSLEEKIKLMRLVVRHKHELVDRKTSEFYAKIARIGYEDEGLAIHTESACRNQIISIMRVYEQRLAHRQPGMKTTPEEDELDQLCDEWKARLSELQQYREKFLVGKRKCDCNDEINERLKKLTEEQQNVDMLVAKVNFLSKHLHDNEEKLMQVNAKMDEVLAENKRLQQLLDHNDLLSKLEPPSAYAPHGVNMGTNMGANMGANMNAIRGGLHSSISPNLGDH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	SYKRKNASLSPSSSP HHHHCCCCCCCCCCH	38.48	28889911
19	Phosphorylation	KRKNASLSPSSSPAK HHCCCCCCCCCCHHH	21.90	28889911
21	Phosphorylation	KNASLSPSSSPAKAQ CCCCCCCCCCHHHHH	39.82	21712547
22	Phosphorylation	NASLSPSSSPAKAQR CCCCCCCCCHHHHHH	43.66	24763107
23	Phosphorylation	ASLSPSSSPAKAQRT CCCCCCCCHHHHHHH	32.96	24763107
245	Phosphorylation	AIRGGLHSSISPNLG HHHCCCCCCCCCCCC	34.12	25720772
246	Phosphorylation	IRGGLHSSISPNLGD HHCCCCCCCCCCCCC	19.15	25720772
248	Phosphorylation	GGLHSSISPNLGDH- CCCCCCCCCCCCCC-	15.08	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SAP1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SAP1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SAP1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CHK1_SCHPO	chk1	genetic	17151242
RAD3_SCHPO	rad3	genetic	17151242
SAP1_SCHPO	sap1	physical	8065904
CDS1_SCHPO	cds1	genetic	17151242
FLP1_SCHPO	clp1	physical	23297348
RAD22_SCHPO	rad52	physical	23779158
SAP1_SCHPO	sap1	physical	26771498
RAD22_SCHPO	rad52	genetic	28490498
CDC18_SCHPO	cdc18	physical	28223353

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of fission yeast.";
Wilson-Grady J.T., Villen J., Gygi S.P.;
J. Proteome Res. 7:1088-1097(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-17 AND SER-19, AND MASSSPECTROMETRY.
PubMed: 18257517