RM15_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RM15_YEAST
• UniProt AC: P36523
• Protein Name: 54S ribosomal protein L15, mitochondrial
• Gene Name: MRPL15
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 253
• Subcellular Localization: Mitochondrion . Mitoribosomes are tethered to the mitochondrial inner membrane and spatially aligned with the membrane insertion machinery through two distinct membrane contact sites, formed by the 21S rRNA expansion segment 96-ES1 and the inner memb
• Protein Description: Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane..
• Protein Sequence: MENSMMFISRSLRRPVTALNCNLQSVRTVIYLHKGPRINGLRRDPESYLRNPSGVLFTEVNAKECQDKVRSILQLPKYGINLSNELILQCLTHKSFAHGSKPYNEKLNLLGAQFLKLQTCIHSLKNGSPAESCENGQLSLQFSNLGTKFAKELTSKNTACTFVKLHNLDPFIFWKMRDPIKDGHINGETTIFASVLNAFIGAILSTNGSEKAAKFIQGSLLDKEDLHSLVNIANENVASAKAKISDKENKAFL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	ENSMMFISRSLRRPV CCCCCHHHHHCCCCC	12.45	28132839
25	Phosphorylation	ALNCNLQSVRTVIYL ECCCCCCCEEEEEEE	19.41	27017623
223	Acetylation	IQGSLLDKEDLHSLV HHCCCCCHHHHHHHH	53.77	24489116
228	Phosphorylation	LDKEDLHSLVNIANE CCHHHHHHHHHHCHH	41.11	27017623
239	Phosphorylation	IANENVASAKAKISD HCHHCHHHHHHHCCH	26.48	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RM15_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RM15_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RM15_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RM35_YEAST	MRPL35	physical	16554755
RM03_YEAST	MRPL3	physical	16554755
RM40_YEAST	MRPL40	physical	16554755
SRS2_YEAST	SRS2	genetic	21459050
ATPB_YEAST	ATP2	genetic	27811238
GOPC_HUMAN	GOPC	physical	27107014

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.