RGS4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RGS4_HUMAN
• UniProt AC: P49798
• Protein Name: Regulator of G-protein signaling 4
• Gene Name: RGS4
• Organism: Homo sapiens (Human).
• Sequence Length: 205
• Protein Description: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G(z)-alpha is inhibited by phosphorylation of the G-protein. Activity on G(z)-alpha and G(i)-alpha-1 is inhibited by palmitoylation of the G-protein..
• Protein Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	S-palmitoylation	------MCKGLAGLP ------CCCCCCCCC	4.87	21035448
11	Phosphorylation	GLAGLPASCLRSAKD CCCCCCHHHHHHHHH	16.25	26356563
12	S-palmitoylation	LAGLPASCLRSAKDM CCCCCHHHHHHHHHH	3.88	10608901
15	Phosphorylation	LPASCLRSAKDMKHR CCHHHHHHHHHHHHH	27.07	26356563
30	Phosphorylation	LGFLLQKSDSCEHNS HHHHHHCCCCCCCCC	23.07	24114839
32	Phosphorylation	FLLQKSDSCEHNSSH HHHHCCCCCCCCCCC	28.61	24114839
37	Phosphorylation	SDSCEHNSSHNKKDK CCCCCCCCCCCCCCE	34.58	24114839
38	Phosphorylation	DSCEHNSSHNKKDKV CCCCCCCCCCCCCEE	36.07	24114839
59 (in isoform 3)	Phosphorylation	-	10.27	29507054
78 (in isoform 3)	Phosphorylation	-	14.46	-
80 (in isoform 3)	Phosphorylation	-	7.73	-
81 (in isoform 3)	Phosphorylation	-	34.48	-
82 (in isoform 3)	Phosphorylation	-	43.87	-
92 (in isoform 3)	Phosphorylation	-	4.28	-
95	S-palmitoylation	NIDFWISCEEYKKIK HCCEEEEHHHHHCCC	3.20	10608901
103	Phosphorylation	EEYKKIKSPSKLSPK HHHHCCCCHHHCCHH	37.57	27732954
105	Phosphorylation	YKKIKSPSKLSPKAK HHCCCCHHHCCHHHH	54.01	27732954
108	Phosphorylation	IKSPSKLSPKAKKIY CCCHHHCCHHHHHHH	28.26	27732954

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
52	S	Phosphorylation	Kinase	PKA-FAMILY	-	GPS

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
2	C	Palmitoylation	Palmitoylated on Cys-2 and/or Cys-12.	10608901
12	C	Palmitoylation	Palmitoylated on Cys-2 and/or Cys-12.	10608901

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RGS4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COPB2_HUMAN	COPB2	physical	10982407
GNAQ_HUMAN	GNAQ	physical	14634662
ERBB3_HUMAN	ERBB3	physical	12840049
GNAI1_HUMAN	GNAI1	physical	9660808
GNAI2_HUMAN	GNAI2	physical	9660808
GNAO_HUMAN	GNAO1	physical	9660808
GNAQ_HUMAN	GNAQ	physical	9660808
GNAI1_BOVIN	GNAI1	physical	9405622
GNAT1_BOVIN	GNAT1	physical	9405622
KRIT1_HUMAN	KRIT1	physical	10747990
GABR1_HUMAN	GABBR1	physical	17185339
GNAI1_HUMAN	GNAI1	physical	22310500
PPCEL_HUMAN	PREPL	physical	28514442
GNAQ_HUMAN	GNAQ	physical	10727532
GNAO_HUMAN	GNAO1	physical	10727532

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 604906: Schizophrenia 9 (SCZD9)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Palmitoylation

"Palmitoylation of a conserved cysteine in the regulator of G proteinsignaling (RGS) domain modulates the GTPase-activating activity ofRGS4 and RGS10.";
Tu Y., Popov S., Slaughter C., Ross E.M.;
J. Biol. Chem. 274:38260-38267(1999).
Cited for: PALMITOYLATION AT CYS-2; CYS-12 AND CYS-95.
PubMed: 10608901