UniProt ID | GNAT1_BOVIN | |
---|---|---|
UniProt AC | P04695 | |
Protein Name | Guanine nucleotide-binding protein G(t) subunit alpha-1 | |
Gene Name | GNAT1 | |
Organism | Bos taurus (Bovine). | |
Sequence Length | 350 | |
Subcellular Localization |
Cell projection, cilium, photoreceptor outer segment . Membrane Peripheral membrane protein . |
|
Protein Description | Functions as signal transducer for the rod photoreceptor RHO. [PubMed: 21285355] | |
Protein Sequence | MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFSEKIKKAHLSICFPDYNGPNTYEDAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | N-myristoyl glycine | ------MGAGASAEE ------CCCCCCHHH | 32.49 | - | |
2 | Myristoylation | ------MGAGASAEE ------CCCCCCHHH | 32.49 | 1436039 | |
142 | Phosphorylation | CFDRASEYQLNDSAG HHHHHHHCCCCCCCC | 18.79 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GNAT1_BOVIN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GNAT1_BOVIN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GNAT1_BOVIN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...