UniProt ID | RAB7B_HUMAN | |
---|---|---|
UniProt AC | Q96AH8 | |
Protein Name | Ras-related protein Rab-7b | |
Gene Name | RAB7B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 199 | |
Subcellular Localization |
Late endosome . Lysosome . Golgi apparatus . Golgi apparatus, trans-Golgi network . Cytoplasmic vesicle, phagosome . Cytoplasmic vesicle, phagosome membrane Lipid-anchor Cytoplasmic side . Recruited to phagosomes containing S.aureus or M.tubercul |
|
Protein Description | Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway.. | |
Protein Sequence | MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Phosphorylation | YQTTLGASILSKIII HHHHHHHHHHHCEEE | 23.43 | 24719451 | |
72 | Phosphorylation | GGQERFRSMVSTFYK CCHHHHHHHHHHHHC | 22.33 | 29083192 | |
75 | Phosphorylation | ERFRSMVSTFYKGSD HHHHHHHHHHHCCCC | 12.26 | 29083192 | |
76 | Phosphorylation | RFRSMVSTFYKGSDG HHHHHHHHHHCCCCC | 21.41 | 29083192 | |
78 | Phosphorylation | RSMVSTFYKGSDGCI HHHHHHHHCCCCCEE | 17.96 | 29083192 | |
175 | Phosphorylation | ASRALSRYQSILENH HHHHHHHHHHHHHHH | 11.84 | 24706070 | |
184 | Phosphorylation | SILENHLTESIKLSP HHHHHHCHHHCCCCC | 21.82 | 30266825 | |
186 | Phosphorylation | LENHLTESIKLSPDQ HHHHCHHHCCCCCCH | 21.56 | 30266825 | |
198 | Geranylgeranylation | PDQSRSRCC------ CCHHHCCCC------ | 3.22 | - | |
199 | Geranylgeranylation | DQSRSRCC------- CHHHCCCC------- | 6.41 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB7B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAB7B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB7B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RN115_HUMAN | RNF115 | physical | 12972561 | |
A4_HUMAN | APP | physical | 21832049 | |
RAP1B_HUMAN | RAP1B | physical | 21988832 | |
RAE1_HUMAN | CHM | physical | 28514442 | |
RAE2_HUMAN | CHML | physical | 28514442 | |
PGTA_HUMAN | RABGGTA | physical | 28514442 | |
PGTB2_HUMAN | RABGGTB | physical | 28514442 | |
ATE1_HUMAN | ATE1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...