RAB7B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB7B_HUMAN
• UniProt AC: Q96AH8
• Protein Name: Ras-related protein Rab-7b
• Gene Name: RAB7B
• Organism: Homo sapiens (Human).
• Sequence Length: 199
• Subcellular Localization: Late endosome . Lysosome . Golgi apparatus . Golgi apparatus, trans-Golgi network . Cytoplasmic vesicle, phagosome . Cytoplasmic vesicle, phagosome membrane ; Lipid-anchor ; Cytoplasmic side . Recruited to phagosomes containing S.aureus or M.tubercul
• Protein Description: Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway..
• Protein Sequence: MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Phosphorylation	YQTTLGASILSKIII HHHHHHHHHHHCEEE	23.43	24719451
72	Phosphorylation	GGQERFRSMVSTFYK CCHHHHHHHHHHHHC	22.33	29083192
75	Phosphorylation	ERFRSMVSTFYKGSD HHHHHHHHHHHCCCC	12.26	29083192
76	Phosphorylation	RFRSMVSTFYKGSDG HHHHHHHHHHCCCCC	21.41	29083192
78	Phosphorylation	RSMVSTFYKGSDGCI HHHHHHHHCCCCCEE	17.96	29083192
175	Phosphorylation	ASRALSRYQSILENH HHHHHHHHHHHHHHH	11.84	24706070
184	Phosphorylation	SILENHLTESIKLSP HHHHHHCHHHCCCCC	21.82	30266825
186	Phosphorylation	LENHLTESIKLSPDQ HHHHCHHHCCCCCCH	21.56	30266825
198	Geranylgeranylation	PDQSRSRCC------ CCHHHCCCC------	3.22	-
199	Geranylgeranylation	DQSRSRCC------- CHHHCCCC-------	6.41	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAB7B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAB7B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB7B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RN115_HUMAN	RNF115	physical	12972561
A4_HUMAN	APP	physical	21832049
RAP1B_HUMAN	RAP1B	physical	21988832
RAE1_HUMAN	CHM	physical	28514442
RAE2_HUMAN	CHML	physical	28514442
PGTA_HUMAN	RABGGTA	physical	28514442
PGTB2_HUMAN	RABGGTB	physical	28514442
ATE1_HUMAN	ATE1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.