R4RL1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: R4RL1_HUMAN
• UniProt AC: Q86UN2
• Protein Name: Reticulon-4 receptor-like 1
• Gene Name: RTN4RL1 {ECO:0000312|HGNC:HGNC:21329}
• Organism: Homo sapiens (Human).
• Sequence Length: 441
• Subcellular Localization: Cell membrane ; Lipid-anchor, GPI-anchor . Membrane raft . Perikaryon . Cell projection . Localized to the surface of neurons, including axons.
• Protein Description: Cell surface receptor. Plays a functionally redundant role in postnatal brain development and in regulating axon regeneration in the adult central nervous system. Contributes to normal axon migration across the brain midline and normal formation of the corpus callosum. Protects motoneurons against apoptosis; protection against apoptosis is probably mediated by MAG. Plays a role in inhibiting neurite outgrowth and axon regeneration via its binding to neuronal chondroitin sulfate proteoglycans. Binds heparin (By similarity). Like other family members, plays a role in restricting the number dendritic spines and the number of synapses that are formed during brain development. [PubMed: 22325200 Signaling mediates activation of Rho and downstream reorganization of the actin cytoskeleton]
• Protein Sequence: MLRKGCCVELLLLLVAAELPLGGGCPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQPGHFSPAMVTLWIYSNNITYIHPSTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGVFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQASSASSLGASLLAWTLGLAVTLR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
294	Ubiquitination	LRHGQDLKLLRAEDF CCCCCCHHEEEHHHH	54.48	-
317	Phosphorylation	PHQIKSHTLTTTDRA HHHHHCCCCCCCCHH	32.65	24275569
420	GPI-anchor	PSGVQQASSASSLGA CCHHHCCCCHHHHHH	23.31	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of R4RL1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of R4RL1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of R4RL1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR107_HUMAN	KRTAP10-7	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.