UniProt ID | PYL11_ARATH | |
---|---|---|
UniProt AC | Q9FJ50 | |
Protein Name | Abscisic acid receptor PYL11 | |
Gene Name | PYL11 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 161 | |
Subcellular Localization | Cytoplasm . Nucleus . Cell membrane . Localizes at the plasma membrane in the presence of a CAR protein. | |
Protein Description | Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition. Inhibits the activity of group-A protein phosphatases type 2C (PP2Cs) when activated by ABA (By similarity). Suppresses the phosphatase activity of TOPP1 in a dose-dependent manner in vitro. [PubMed: 26943172] | |
Protein Sequence | METSQKYHTCGSTLVQTIDAPLSLVWSILRRFDNPQAYKQFVKTCNLSSGDGGEGSVREVTVVSGLPAEFSRERLDELDDESHVMMISIIGGDHRLVNYRSKTMAFVAADTEEKTVVVESYVVDVPEGNSEEETTSFADTIVGFNLKSLAKLSERVAHLKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PYL11_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PYL11_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PYL11_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PYL11_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PYL13_ARATH | PYL13 | physical | 24189045 | |
P2C16_ARATH | HAB1 | physical | 19407142 | |
P2C77_ARATH | ABI2 | physical | 25969135 | |
P2C16_ARATH | HAB1 | physical | 25969135 | |
P2C37_ARATH | PP2CA | physical | 25969135 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...