dbPTM

PYGO_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PYGO_DROME
UniProt AC	Q9V9W8
Protein Name	Protein pygopus
Gene Name	pygo
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	815
Subcellular Localization	Nucleus.
Protein Description	Involved in signal transduction through the Wnt pathway..
Protein Sequence	MTHNLGMAPYRLPGPAGGLCPPDFKPPPPTDIISAPSNPKKRRKTSSAANSAAAVAAAAAAAAAANSMQQQQAPPTPQDLLPPPPMGGFGDTIIASNPFDDSPQVSAMSSSAAAAMAAMNQMGGGPGGGHFGGGGPGGHPHWEDRMGMGGGPPPPPHMHPHMHPHHPGGPMGHPHGPHPHMGGPPPMRGMSPMHPHQMGPGPGVGLPPHMNHGRPGGPGGPGGPVPMGSPMGGIAGMGGMSPMGGMGGPSISPHHMGMGGLSPMGGGPNGPNPRAMQGSPMGGPGQNSPMNSLPMGSPMGNPIGSPLGPPSGPGPGNPGNTGGPQQQQQQPPQPPMNNGQMGPPPLHSPLGNGPTGHGSHMPGGPIPGPGPGPGGLVGPGGISPAHGNNPGGSGNNMLGGNPGGGNSNNNGSNTSNASNNNQNPHLSPAAGRLGVPTSMQSNGPSVSSVASSSVPSPATPTLTPTSTATSMSTSVPTSSPAPPAMSPHHSLNSAGPSPGMPNSGPSPLQSPAGPNGPNNNNSNNNNGPMMGQMIPNAVPMQHQQHMGGGPPGHGPGPMPGMGMNQMLPPQQPSHLGPPHPNMMNHPHHPHHHPGGPPPHMMGGPGMHGGPAGMPPHMGGGPNPHMMGGPHGNAGPHMGHGHMGGVPGPGPGPGGMNGPPHPHMSPHHGHPHHHHNPMGGPGPNMFGGGGGGPMGPGGPMGNMGPMGGGPMGGPMGVGPKPMTMGGGKMYPPGQPMVFNPQNPNAPPIYPCGMCHKEVNDNDEAVFCESGCNFFFHRTCVGLTEAAFQMLNKEVFAEWCCDKCVSSKHIPMVKFKC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of PYGO_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PYGO_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PYGO_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PYGO_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARM_DROME	arm	genetic	15208637
CCNE_DROME	CycE	genetic	12242236
CTBP_DROME	CtBP	genetic	21468031
ARM_DROME	arm	physical	15043810
BCL9_DROME	lgs	physical	14612447
BCL9_DROME	lgs	physical	15043810

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PYGO_DROME

Related Literatures of Post-Translational Modification