UniProt ID | PTOV1_HUMAN | |
---|---|---|
UniProt AC | Q86YD1 | |
Protein Name | Prostate tumor-overexpressed gene 1 protein | |
Gene Name | PTOV1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 416 | |
Subcellular Localization | Cell membrane. Cytoplasm, perinuclear region. Nucleus. Translocates from the cytoplasm to the nucleus at the onset of S-phase. Also localizes to lipid rafts. | |
Protein Description | May activate transcription. Required for nuclear translocation of FLOT1. Promotes cell proliferation.. | |
Protein Sequence | MVRPRRAPYRSGAGGPLGGRGRPPRPLVVRAVRSRSWPASPRGPQPPRIRARSAPPMEGARVFGALGPIGPSSPGLTLGGLAVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVSAIRQVITTRKQAVGPGGVNSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTEQWPRKLYMQLIPQQLLTTLVPLFRNSRLVQFHFTKDLETLKSLCRIMDNGFAGCVHFSYKASCEIRVLMLLYSSEKKIFIGLIPHDQGNFVNGIRRVIANQQQVLQRNLEQEQQQRGMGG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | PRRAPYRSGAGGPLG CCCCCCCCCCCCCCC | 27.44 | 28555341 | |
23 (in isoform 3) | Ubiquitination | - | 31.88 | 21890473 | |
34 | Phosphorylation | LVVRAVRSRSWPASP EEEEEHHHCCCCCCC | 24.86 | 30266825 | |
36 | Phosphorylation | VRAVRSRSWPASPRG EEEHHHCCCCCCCCC | 38.36 | 23927012 | |
40 | Phosphorylation | RSRSWPASPRGPQPP HHCCCCCCCCCCCCC | 15.85 | 30266825 | |
48 (in isoform 3) | Ubiquitination | - | 37.39 | 21890473 | |
53 | Phosphorylation | PPRIRARSAPPMEGA CCCCCCCCCCCCCCC | 44.11 | 23401153 | |
59 (in isoform 2) | Ubiquitination | - | 16.66 | 21890473 | |
72 (in isoform 2) | Ubiquitination | - | 43.91 | 21890473 | |
72 | Phosphorylation | ALGPIGPSSPGLTLG ECCCCCCCCCCCCCC | 43.91 | 28450419 | |
73 | Phosphorylation | LGPIGPSSPGLTLGG CCCCCCCCCCCCCCC | 26.56 | 30175587 | |
77 | Phosphorylation | GPSSPGLTLGGLAVS CCCCCCCCCCCCEEC | 29.31 | 28464451 | |
84 | Phosphorylation | TLGGLAVSEHRLSNK CCCCCEECCHHHHCC | 23.29 | 27251275 | |
89 | Phosphorylation | AVSEHRLSNKLLAWS EECCHHHHCCCHHHH | 31.69 | 28674151 | |
91 | Ubiquitination | SEHRLSNKLLAWSGV CCHHHHCCCHHHHHH | 41.31 | 21890473 | |
91 (in isoform 1) | Ubiquitination | - | 41.31 | 21890473 | |
104 (in isoform 1) | Ubiquitination | - | 38.31 | 21890473 | |
104 | Ubiquitination | GVLEWQEKRRPYSDS HHHHHHHHCCCCCCC | 38.31 | 21890473 | |
114 | Ubiquitination | PYSDSTAKLKRTLPC CCCCCHHHHHCCCCC | 55.41 | - | |
116 | Ubiquitination | SDSTAKLKRTLPCQA CCCHHHHHCCCCCCE | 42.50 | - | |
142 (in isoform 3) | Ubiquitination | - | 3.72 | 21890473 | |
144 (in isoform 2) | Ubiquitination | - | 3.23 | 21890473 | |
148 (in isoform 3) | Ubiquitination | - | 32.84 | 21890473 | |
176 (in isoform 1) | Ubiquitination | - | 54.51 | 21890473 | |
176 | Ubiquitination | NRDCDSLKGLCRIMG CCCHHHHHHHHHHHC | 54.51 | 21906983 | |
180 (in isoform 2) | Ubiquitination | - | 27.28 | 21890473 | |
184 (in isoform 3) | Ubiquitination | - | 25.65 | 21890473 | |
205 (in isoform 2) | Ubiquitination | - | 3.38 | 21890473 | |
212 | Ubiquitination | LLYSSKKKIFMGLIP HHHHCCCEEEEECCC | 44.93 | 21890473 | |
212 (in isoform 1) | Ubiquitination | - | 44.93 | 21890473 | |
220 | Phosphorylation | IFMGLIPYDQSGFVS EEEECCCCCCCHHHH | 21.44 | 27174698 | |
223 | Phosphorylation | GLIPYDQSGFVSAIR ECCCCCCCHHHHHHH | 31.16 | 27174698 | |
224 (in isoform 2) | Ubiquitination | - | 22.72 | - | |
227 | Phosphorylation | YDQSGFVSAIRQVIT CCCCHHHHHHHHHHH | 18.73 | 27174698 | |
234 | Phosphorylation | SAIRQVITTRKQAVG HHHHHHHHHCCCCCC | 22.99 | 27174698 | |
235 | Phosphorylation | AIRQVITTRKQAVGP HHHHHHHHCCCCCCC | 25.42 | 27174698 | |
237 | Ubiquitination | RQVITTRKQAVGPGG HHHHHHCCCCCCCCC | 40.28 | 21890473 | |
237 (in isoform 1) | Ubiquitination | - | 40.28 | 21890473 | |
247 | Phosphorylation | VGPGGVNSGPVQIVN CCCCCCCCCCEEEEC | 41.91 | 23532336 | |
275 | Phosphorylation | EPRPEPNSRSKRWLP CCCCCCCCCCCCCCC | 48.96 | 23532336 | |
277 | Phosphorylation | RPEPNSRSKRWLPSH CCCCCCCCCCCCCCC | 26.79 | 24719451 | |
286 | Phosphorylation | RWLPSHVYVNQGEIL CCCCCCEEECCCCEE | 6.56 | - | |
299 (in isoform 2) | Ubiquitination | - | 24.19 | 21890473 | |
301 | Ubiquitination | RTEQWPRKLYMQLIP CCCCCCHHHHHHHHH | 39.63 | - | |
305 (in isoform 2) | Ubiquitination | - | 23.76 | 21890473 | |
318 (in isoform 2) | Ubiquitination | - | 4.99 | - | |
331 | Ubiquitination | LVQFHFTKDLETLKS EEEEEECCCHHHHHH | 60.41 | 21890473 | |
331 (in isoform 1) | Ubiquitination | - | 60.41 | 21890473 | |
337 | Ubiquitination | TKDLETLKSLCRIMD CCCHHHHHHHHHHHH | 49.12 | 21890473 | |
337 (in isoform 1) | Ubiquitination | - | 49.12 | 21890473 | |
338 | Phosphorylation | KDLETLKSLCRIMDN CCHHHHHHHHHHHHC | 35.50 | 24961811 | |
368 | Phosphorylation | IRVLMLLYSSEKKIF HHEHHHHHCCCCEEE | 13.24 | 30177828 | |
369 | Phosphorylation | RVLMLLYSSEKKIFI HEHHHHHCCCCEEEE | 31.80 | 30177828 | |
370 | Phosphorylation | VLMLLYSSEKKIFIG EHHHHHCCCCEEEEE | 39.62 | 30177828 | |
373 | Ubiquitination | LLYSSEKKIFIGLIP HHHCCCCEEEEEECC | 38.50 | 21890473 | |
373 (in isoform 1) | Ubiquitination | - | 38.50 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTOV1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTOV1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTOV1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DEMA_HUMAN | DMTN | physical | 16169070 | |
PIN1_HUMAN | PIN1 | physical | 16169070 | |
SPTN1_HUMAN | SPTAN1 | physical | 16169070 | |
RACK1_HUMAN | GNB2L1 | physical | 23455324 | |
RS6_HUMAN | RPS6 | physical | 23455324 | |
FLOT1_HUMAN | FLOT1 | physical | 15713644 | |
HDAC1_HUMAN | HDAC1 | physical | 27173435 | |
XYLT2_HUMAN | XYLT2 | physical | 27173435 | |
RTCB_HUMAN | RTCB | physical | 27173435 | |
MTA2_HUMAN | MTA2 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...