| UniProt ID | PROP_HUMAN | |
|---|---|---|
| UniProt AC | P27918 | |
| Protein Name | Properdin | |
| Gene Name | CFP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 469 | |
| Subcellular Localization | Secreted. | |
| Protein Description | A positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes.. | |
| Protein Sequence | MITEGAQAPRLLLPPLLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWSTWAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 39 | Phosphorylation | CFTQYEESSGKCKGL EEEEEECCCCCCCCC | 32.24 | - | |
| 40 | Phosphorylation | FTQYEESSGKCKGLL EEEEECCCCCCCCCC | 45.62 | - | |
| 83 | C-linked_Glycosylation | RSPRWSLWSTWAPCS CCCCCCEECCCCCCE | 6.54 | 31507604 | |
| 86 | C-linked_Glycosylation | RWSLWSTWAPCSVTC CCCEECCCCCCEEEE | 7.84 | 31507604 | |
| 92 | O-linked_Glycosylation | TWAPCSVTCSEGSQL CCCCCEEEECCCCEE | 8.27 | 12096136 | |
| 139 | C-linked_Glycosylation | CCPEMGGWSGWGPWE CCCCCCCCCCCCCCC | 6.48 | 31507604 | |
| 142 | C-linked_Glycosylation | EMGGWSGWGPWEPCS CCCCCCCCCCCCCCE | 12.26 | 31507604 | |
| 145 | C-linked_Glycosylation | GWSGWGPWEPCSVTC CCCCCCCCCCCEEEE | 20.44 | 31507604 | |
| 151 | O-linked_Glycosylation | PWEPCSVTCSKGTRT CCCCCEEEECCCCHH | 8.51 | 12096136 | |
| 196 | C-linked_Glycosylation | VCPTHGAWATWGPWT CCCCCCCCCCCCCCC | 9.98 | 31507604 | |
| 199 | C-linked_Glycosylation | THGAWATWGPWTPCS CCCCCCCCCCCCCCC | 11.78 | 31507604 | |
| 202 | C-linked_Glycosylation | AWATWGPWTPCSASC CCCCCCCCCCCCCCC | 14.72 | 31507604 | |
| 208 | O-linked_Glycosylation | PWTPCSASCHGGPHE CCCCCCCCCCCCCCC | 7.14 | 12096136 | |
| 260 | C-linked_Glycosylation | PCPVAGGWGPWGPVS CCCCCCCCCCCCCCC | 14.57 | 31507604 | |
| 263 | C-linked_Glycosylation | VAGGWGPWGPVSPCP CCCCCCCCCCCCCCC | 21.56 | 31507604 | |
| 272 | O-linked_Glycosylation | PVSPCPVTCGLGQTM CCCCCCCCCCCCCCC | 5.99 | 12096136 | |
| 278 | Phosphorylation | VTCGLGQTMEQRTCN CCCCCCCCCCCEECC | 22.37 | 28787133 | |
| 321 | C-linked_Glycosylation | VDGEWDSWGEWSPCI CCCCCCCCCCCCHHH | 13.27 | 31507604 | |
| 324 | C-linked_Glycosylation | EWDSWGEWSPCIRRN CCCCCCCCCHHHHHH | 12.02 | 31507604 | |
| 325 | Phosphorylation | WDSWGEWSPCIRRNM CCCCCCCCHHHHHHC | 12.94 | 22468782 | |
| 334 | Phosphorylation | CIRRNMKSISCQEIP HHHHHCCCCCCEECC | 14.68 | 22468782 | |
| 336 | Phosphorylation | RRNMKSISCQEIPGQ HHHCCCCCCEECCCC | 19.48 | 22468782 | |
| 382 | C-linked_Glycosylation | HCPLKGSWSEWSTWG CCCCCCCHHHCCCCE | 14.67 | 31507604 | |
| 385 | C-linked_Glycosylation | LKGSWSEWSTWGLCM CCCCHHHCCCCEEEC | 8.78 | 31507604 | |
| 388 | C-linked_Glycosylation | SWSEWSTWGLCMPPC CHHHCCCCEEECCCC | 7.70 | 31507604 | |
| 400 | Phosphorylation | PPCGPNPTRARQRLC CCCCCCHHHHHHHHC | 43.53 | 30257219 | |
| 428 | N-linked_Glycosylation | VEGQGEKNVTFWGRP ECCCCCCCEEEECEE | 33.49 | 16335952 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PROP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PROP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PROP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| B3GLT_HUMAN | B3GALTL | physical | 28514442 | |
| D19L3_HUMAN | DPY19L3 | physical | 28514442 | |
| CRAC1_HUMAN | CRTAC1 | physical | 28514442 | |
| CRBN_HUMAN | CRBN | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 312060 | Properdin deficiency (PFD) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| C-linked Glycosylation | |
| Reference | PubMed |
| "Properdin, the positive regulator of complement, is highly C-mannosylated."; Hartmann S., Hofsteenge J.; J. Biol. Chem. 275:28569-28574(2000). Cited for: GLYCOSYLATION AT TRP-83; TRP-86; TRP-139; TRP-142; TRP-145; TRP-196;TRP-199; TRP-260; TRP-263; TRP-321; TRP-324; TRP-382; TRP-385 ANDTRP-388. | |
| N-linked Glycosylation | |
| Reference | PubMed |
| "Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry."; Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.; J. Proteome Res. 4:2070-2080(2005). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-428, AND MASSSPECTROMETRY. | |
| O-linked Glycosylation | |
| Reference | PubMed |
| "C-mannosylation and O-fucosylation of thrombospondin type 1repeats."; Gonzalez de Peredo A., Klein D., Macek B., Hess D.,Peter-Katalinic J., Hofsteenge J.; Mol. Cell. Proteomics 1:11-18(2002). Cited for: GLYCOSYLATION AT THR-92; THR-151; SER-208 AND THR-272. | |
