PR1B2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PR1B2_ARATH
• UniProt AC: Q9SIY7
• Protein Name: PRA1 family protein B2
• Gene Name: PRA1B2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 213
• Subcellular Localization: Endosome membrane ; Multi-pass membrane protein .
• Protein Description: May be involved in both secretory and endocytic intracellular trafficking in the endosomal/prevacuolar compartments..
• Protein Sequence: MSSSPAILPVTNQQAATQSQPPINSHAFRTFLSRLSSSLRESLSQRRPWLELVDRSSFARPDSLTDSFSRIRKNLAYFKVNYSAIVSLVLAFSLLSHPFSLLVLLSLLGSWMFLYLFRSSDQPLVLFGRSFSDRETLLGLVLTTIVVVFMTSVGSLLTSALTIGIAIVCLHGAFRVPDDLFLDEQEPANAGLLSFIGNSAATSAAASVVAGRV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PR1B2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PR1B2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PR1B2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PR1B2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PR1B2_ARATH	PRA1.B2	physical	21798944
RTNLD_ARATH	BTI3	physical	21798944
SAR1A_ARATH	SAR2	physical	21798944
RTNLH_ARATH	AT3G10260	physical	21798944
PR1B6_ARATH	PRA1.B6	physical	21798944
RAF2A_ARATH	RHA1	physical	21798944
PR1B5_ARATH	PRA1.B5	physical	21798944
RAE1A_ARATH	RAB8	physical	21798944
RABD1_ARATH	ATFP8	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.