dbPTM

RAF2A_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAF2A_ARATH
UniProt AC	P31582
Protein Name	Ras-related protein RABF2a
Gene Name	RABF2A
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	200
Subcellular Localization	Endosome membrane Lipid-anchor . Prevacuolar compartment membrane Lipid-anchor .
Protein Description	Involved in the trafficking of soluble cargo proteins from the prevacuolar compartment to the central vacuole. [PubMed: 12724533]
Protein Sequence	MASSGNKNINAKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDITNQASFERAKKWVQELQAQGNPNMVMALAGNKADLLDARKVSAEEAEIYAQENSLFFMETSAKTATNVKDIFYEIAKRLPRVQPAENPTGMVLPNGPGATAVSSSCCA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
198	Geranylgeranylation	ATAVSSSCCA----- CEEECCCCCC-----	2.16	-
199	Geranylgeranylation	TAVSSSCCA------ EEECCCCCC------	5.63	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAF2A_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAF2A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAF2A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RAF2A_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAF2A_ARATH

Related Literatures of Post-Translational Modification