| UniProt ID | RABD1_ARATH | |
|---|---|---|
| UniProt AC | Q9ZRE2 | |
| Protein Name | Ras-related protein RABD1 | |
| Gene Name | RABD1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 205 | |
| Subcellular Localization |
Golgi apparatus, trans-Golgi network membrane . Golgi apparatus membrane Lipid-anchor . |
|
| Protein Description | Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER).. | |
| Protein Sequence | MSNEYDYLFKLLLIGDSSVGKSCLLLRFADDAYIDSYISTIGVDFKIRTIEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDCTEMESFNNVKQWLSEIDRYANESVCKLLIGNKNDMVESKVVSTETGRALADELGIPFLETSAKDSINVEQAFLTIAGEIKKKMGSQTNANKTSGPGTVQMKGQPIQQNNGGCCGQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSNEYDYLF ------CCCHHHHHH | 38.07 | 22223895 | |
| 2 | Phosphorylation | ------MSNEYDYLF ------CCCHHHHHH | 38.07 | 25561503 | |
| 5 | Phosphorylation | ---MSNEYDYLFKLL ---CCCHHHHHHHHH | 17.71 | 25561503 | |
| 7 | Phosphorylation | -MSNEYDYLFKLLLI -CCCHHHHHHHHHHC | 17.09 | 25561503 | |
| 74 | Phosphorylation | QERFRTITSSYYRGA HHHHHHHHHHHHCCC | 15.82 | 25561503 | |
| 75 | Phosphorylation | ERFRTITSSYYRGAH HHHHHHHHHHHCCCC | 16.70 | 29654922 | |
| 202 | Geranylgeranylation | IQQNNGGCCGQ---- CCCCCCCCCCC---- | 2.21 | - | |
| 203 | Geranylgeranylation | QQNNGGCCGQ----- CCCCCCCCCC----- | 6.78 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RABD1_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RABD1_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RABD1_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MYO6_ARATH | MYA2 | physical | 18703495 | |
| RTNLL_ARATH | AT3G54120 | physical | 21798944 | |
| PR1F4_ARATH | PRA1.F4 | physical | 21798944 | |
| PR1B6_ARATH | PRA1.B6 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
