UniProt ID | PPR3B_HUMAN | |
---|---|---|
UniProt AC | Q86XI6 | |
Protein Name | Protein phosphatase 1 regulatory subunit 3B | |
Gene Name | PPP1R3B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 285 | |
Subcellular Localization | ||
Protein Description | Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes (By similarity).. | |
Protein Sequence | MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | FKISPKPSKPLRPCI EECCCCCCCCCCCEE | 53.70 | 24719451 | |
57 | Acetylation | VAPAVQEKKVKKRVS CCHHHHHHCHHCCCC | 45.86 | 19819195 | |
58 | Ubiquitination | APAVQEKKVKKRVSF CHHHHHHCHHCCCCC | 59.54 | - | |
141 | Ubiquitination | CLENCVLKDKAIAGT EEECCEECCCCEECE | 36.46 | - | |
143 | Ubiquitination | ENCVLKDKAIAGTVK ECCEECCCCEECEEE | 39.85 | - | |
148 | Phosphorylation | KDKAIAGTVKVQNLA CCCCEECEEEEEEEE | 14.24 | - | |
150 | Ubiquitination | KAIAGTVKVQNLAFE CCEECEEEEEEEEEE | 37.63 | 29967540 | |
158 | Ubiquitination | VQNLAFEKTVKIRMT EEEEEEEEEEEEEEE | 52.76 | 29967540 | |
165 | Phosphorylation | KTVKIRMTFDTWKSY EEEEEEEEECCHHHC | 14.44 | 22210691 | |
168 | Phosphorylation | KIRMTFDTWKSYTDF EEEEEECCHHHCCCC | 30.51 | 22210691 | |
172 | Phosphorylation | TFDTWKSYTDFPCQY EECCHHHCCCCCCCE | 13.45 | - | |
181 | Ubiquitination | DFPCQYVKDTYAGSD CCCCCEEEECCCCCC | 39.14 | 29967540 | |
184 | Phosphorylation | CQYVKDTYAGSDRDT CCEEEECCCCCCCCE | 21.06 | - | |
213 | Phosphorylation | ERMEFAVYYECNGQT CEEEEEEEEEECCEE | 7.07 | - | |
214 | Phosphorylation | RMEFAVYYECNGQTY EEEEEEEEEECCEEE | 13.86 | - | |
230 | Phosphorylation | DSNRGKNYRIIRAEL ECCCCCCEEEEEEEE | 13.48 | 18083107 | |
239 | Phosphorylation | IIRAELKSTQGMTKP EEEEEEECCCCCCCC | 38.29 | 24275569 | |
244 | Phosphorylation | LKSTQGMTKPHSGPD EECCCCCCCCCCCCC | 48.53 | 24275569 | |
248 | Phosphorylation | QGMTKPHSGPDLGIS CCCCCCCCCCCCCCC | 61.62 | 28857561 | |
255 | Phosphorylation | SGPDLGISFDQFGSP CCCCCCCCCHHCCCC | 22.44 | 24275569 | |
261 | Phosphorylation | ISFDQFGSPRCSYGL CCCHHCCCCCCCCCC | 15.51 | 25159151 | |
285 | Phosphorylation | YEKLGPYY------- CCCCCCCC------- | 18.40 | 17870073 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPR3B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPR3B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PP1G_HUMAN | PPP1CC | physical | 26186194 | |
PP1A_HUMAN | PPP1CA | physical | 26186194 | |
NIPS2_HUMAN | GBAS | physical | 26186194 | |
GLYG_HUMAN | GYG1 | physical | 26186194 | |
GYS2_HUMAN | GYS2 | physical | 26186194 | |
GYS1_HUMAN | GYS1 | physical | 26186194 | |
TYY1_HUMAN | YY1 | physical | 26186194 | |
PP1G_HUMAN | PPP1CC | physical | 28514442 | |
TYY1_HUMAN | YY1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...