PORCN_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PORCN_DROME
• UniProt AC: Q9VWV9
• Protein Name: Protein-serine O-palmitoleoyltransferase porcupine {ECO:0000250|UniProtKB:Q9JJJ7}
• Gene Name: por {ECO:0000312|FlyBase:FBgn0004957}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 525
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Protein-serine O-palmitoleoyltransferase that acts as a key regulator of the Wnt signaling pathway by mediating the attachment of palmitoleate, a 16-carbon monounsaturated fatty acid (C16:1), to Wnt proteins. Serine palmitoleylation of Wnt proteins is required for efficient binding to frizzled receptors (By similarity). Also facilitates the glycosylation of Wnt family members, including wg and Wnt5. The cotranslational disulfide bond formation of wg competes with the N-glycosylation. Porc stimulates the post-translational N-glycosylation by anchoring wg at the ER membrane, probably through acylation. [PubMed: 11821428]
• Protein Sequence: MDYQYFEEESDYIDLDEEEEDDDVVTAGSLDHRFGQPNGEEDYYFGGDDVEEELVVDGHGVLELAGRLLESLQSCVQPSVLQVMQYVAPMLLLCLLCRLLCLLYSQRRRLTSLAPLHLFHFACGLIILQITVGYRLLLLLLLAAVGYLLLQLLRLGRRGAQVLAVLTVGSQFLYELLIWRRRSDWPQLRGIQMVVNMKLISLGFDLTASGQLQARIPGPFAYLGYIYSPATCALGPWVSFGCYMDCLVPRNSWLVSLRRLLPNVVICVLAVTVSNCVAPALSDFFGDSSHFLVMYWDALSVRSSHYFVGMMAQALLVASDQRLDGATKESDMLGPLISQPWRIEWPRSISSLVRSWNIPMHEWLKRYIYAPCKPTASTSRGRILVVVLSTYLVSSLLHGMDLRIYLVLISLAFLAEGESLLRRQLASLLNACITANLCPGKERCRYSHCPSKRRLNSLSYWLARLTNLAFTALAIFHLAYLGVVLLGDDLEVGEDGDSFLWHWQQAGYLSHYIGLGTFVLYLFIS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PORCN_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PORCN_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PORCN_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PORCN_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PIPE_DROME	pip	physical	14605208
WNT5_DROME	Wnt5	physical	22108505
WNT4_DROME	Wnt4	physical	22108505
WNTG_DROME	wg	physical	22108505
WNT2_DROME	Wnt2	physical	22108505

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.