UniProt ID | PO3F4_RAT | |
---|---|---|
UniProt AC | P62516 | |
Protein Name | POU domain, class 3, transcription factor 4 | |
Gene Name | Pou3f4 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 361 | |
Subcellular Localization | Nucleus. | |
Protein Description | Probable transcription factor which exert its primary action widely during early neural development and in a very limited set of neurons in the mature brain.. | |
Protein Sequence | MATAASNPYSILSSSSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNSSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASTQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDASCHDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | TAASNPYSILSSSSL CCCCCCCCCCCCCCC | 20.50 | 27097102 | |
13 | Phosphorylation | SNPYSILSSSSLVHA CCCCCCCCCCCCCEE | 26.89 | 27097102 | |
14 | Phosphorylation | NPYSILSSSSLVHAD CCCCCCCCCCCCEEC | 22.09 | 27097102 | |
15 | Phosphorylation | PYSILSSSSLVHADS CCCCCCCCCCCEECC | 25.06 | 27097102 | |
16 | Phosphorylation | YSILSSSSLVHADSA CCCCCCCCCCEECCC | 36.04 | 27097102 | |
22 | Phosphorylation | SSLVHADSAGMQQGS CCCCEECCCCCCCCC | 27.75 | 27097102 | |
29 | Phosphorylation | SAGMQQGSPFRNPQK CCCCCCCCCCCCHHH | 19.27 | 27097102 | |
261 | Phosphorylation | KWLEEADSSTGSPTS HHHHHHHCCCCCCCH | 36.53 | 27097102 | |
262 | Phosphorylation | WLEEADSSTGSPTSI HHHHHHCCCCCCCHH | 37.02 | 27097102 | |
263 | Phosphorylation | LEEADSSTGSPTSID HHHHHCCCCCCCHHH | 45.70 | 27097102 | |
265 | Phosphorylation | EADSSTGSPTSIDKI HHHCCCCCCCHHHHH | 25.70 | 27097102 | |
267 | Phosphorylation | DSSTGSPTSIDKIAA HCCCCCCCHHHHHHH | 39.76 | 27097102 | |
268 | Phosphorylation | SSTGSPTSIDKIAAQ CCCCCCCHHHHHHHC | 31.97 | 27097102 | |
283 | Phosphorylation | GRKRKKRTSIEVSVK CCCCCCCCCCEEEHH | 42.83 | 27097102 | |
284 | Phosphorylation | RKRKKRTSIEVSVKG CCCCCCCCCEEEHHH | 22.30 | 27097102 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PO3F4_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PO3F4_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PO3F4_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HNRPU_HUMAN | HNRNPU | physical | 9105675 | |
PO3F3_MOUSE | Pou3f3 | physical | 9105675 | |
PO3F4_RAT | Pou3f4 | physical | 9105675 | |
PO3F2_MOUSE | Pou3f2 | physical | 9105675 | |
PO3F1_MOUSE | Pou3f1 | physical | 9105675 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...