| UniProt ID | PEX7_ARATH | |
|---|---|---|
| UniProt AC | Q9XF57 | |
| Protein Name | Peroxisome biogenesis protein 7 | |
| Gene Name | PEX7 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 317 | |
| Subcellular Localization |
Cytoplasm . Peroxisome membrane Peripheral membrane protein . The loss of PEX12, PEX13 or PEX14 prevents the targeting of PEX7 to peroxisomes. |
|
| Protein Description | Import receptor for peroxisomal-targeting signal two (PTS2). A receptor-cargo complex composed of PEX5, PEX7, a PTS1-containing protein and a PTS2-containing protein is targeted to peroxisomes during import.. | |
| Protein Sequence | MPVFKAPFNGYSVKFSPFYESRLAVATAQNFGILGNGRIHVLELAPGAPGVTESVSYDTADAVYDVCWSESHDSVLIAAIGDGSVKIYDTALPPPSNPIRSFQEHAREVQSVDYNPTRRDSFLTSSWDDTVKLWAMDRPASVRTFKEHAYCVYQAVWNPKHGDVFASASGDCTLRIWDVREPGSTMIIPAHDFEILSCDWNKYDDCILATSSVDKTVKVWDVRSYRVPLAVLNGHGYAVRKVKFSPHRRSLIASCSYDMSVCLWDYMVEDALVGRYDHHTEFAVGIDMSVLVEGLMASTGWDELVYVWQQGMDPRAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PEX7_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX7_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX7_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX7_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TCPA_ARATH | TCP-1 | physical | 23297417 | |
| CPNB1_ARATH | CPN60B | physical | 23297417 | |
| TCPE_ARATH | AT1G24510 | physical | 23297417 | |
| DRP1A_ARATH | DL1 | physical | 23297417 | |
| PEX5_ARATH | PEX5 | physical | 23297417 | |
| RAE1C_ARATH | RAB8A | physical | 23297417 | |
| RAA1E_ARATH | RABA1e | physical | 23297417 | |
| PEX5_ARATH | PEX5 | physical | 11978862 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
