UniProt ID | PED1A_HUMAN | |
---|---|---|
UniProt AC | Q9H1Q7 | |
Protein Name | PC-esterase domain-containing protein 1A | |
Gene Name | PCED1A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 454 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVFCLSSEEPRRPLRSDMVHFQASEVQQLLHNKFVVILGDSIQRAVYKDLVLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFCSGSGHHLVRFYFLTRVYSEYLEDVLEELTYGPAPDLVIINSCLWDLSRYGRCSMESYRENLERVFVRMDQVLPDSCLLVWNMAMPLGERITGGFLLPELQPLAGSLRRDVVEGNFYSATLAGDHCFDVLDLHFHFRHAVQHRHRDGVHWDQHAHRHLSHLLLTHVADAWGVELPKRGYPPDPWIEDWAEMNHPFQGSHRQTPDFGEHLALLPPPPSSLPPPMPFPYPLPQPSPPPLFPPLPQDTPFFPGQPFPPHEFFNYNPVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQHWGPVVHRGMPRYVPNSPYHVRRMGGPCRQRLRHSERLIHTYKLDRRPPAHSGTWPG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | Ubiquitination | SIQRAVYKDLVLLLQ HHHHHHHHHHHHHHH | 33845483 | ||
61 | Phosphorylation | LQKDSLLTAAQLKAK HHHCCHHHHHHHHHH | 22817900 | ||
149 | Phosphorylation | CLWDLSRYGRCSMES CHHHHHHHCCCCHHH | - | ||
157 | Phosphorylation | GRCSMESYRENLERV CCCCHHHHHHHHHHH | - | ||
175 | Phosphorylation | MDQVLPDSCLLVWNM HHHHCCHHHEEEEEE | 24043423 | ||
191 | Phosphorylation | MPLGERITGGFLLPE CCCCCCCCCCCCCCH | 24043423 | ||
205 | Phosphorylation | ELQPLAGSLRRDVVE HHHHCCCCCCCHHHC | 24043423 | ||
219 | Phosphorylation | EGNFYSATLAGDHCF CCCCEEEEECCCCEE | 25137130 | ||
438 | Phosphorylation | HSERLIHTYKLDRRP HHHHHHEEEECCCCC | 24719451 | ||
439 | Phosphorylation | SERLIHTYKLDRRPP HHHHHEEEECCCCCC | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PED1A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PED1A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PED1A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...