UniProt ID | ORML1_MOUSE | |
---|---|---|
UniProt AC | Q921I0 | |
Protein Name | ORM1-like protein 1 | |
Gene Name | Ormdl1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 153 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
Protein Description | Negative regulator of sphingolipid synthesis.. | |
Protein Sequence | MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSVPVAWTLTNIIHNLGMYVFLHAVKGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTASLLSVLIPKMPQLHGVRIFGINKY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ORML1_MOUSE !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ORML1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ORML1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ORML1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TSPO_HUMAN | TSPO | physical | 26496610 | |
CLK3_HUMAN | CLK3 | physical | 26496610 | |
CPSM_HUMAN | CPS1 | physical | 26496610 | |
RS9_HUMAN | RPS9 | physical | 26496610 | |
HOIL1_HUMAN | RBCK1 | physical | 26496610 | |
LTMD1_HUMAN | LETMD1 | physical | 26496610 | |
MYO1G_HUMAN | MYO1G | physical | 26496610 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...