ORML1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ORML1_MOUSE
• UniProt AC: Q921I0
• Protein Name: ORM1-like protein 1
• Gene Name: Ormdl1
• Organism: Mus musculus (Mouse).
• Sequence Length: 153
• Subcellular Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein.
• Protein Description: Negative regulator of sphingolipid synthesis..
• Protein Sequence: MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSVPVAWTLTNIIHNLGMYVFLHAVKGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTASLLSVLIPKMPQLHGVRIFGINKY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of ORML1_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ORML1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ORML1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ORML1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TSPO_HUMAN	TSPO	physical	26496610
CLK3_HUMAN	CLK3	physical	26496610
CPSM_HUMAN	CPS1	physical	26496610
RS9_HUMAN	RPS9	physical	26496610
HOIL1_HUMAN	RBCK1	physical	26496610
LTMD1_HUMAN	LETMD1	physical	26496610
MYO1G_HUMAN	MYO1G	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.