NKX25_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NKX25_MOUSE
• UniProt AC: P42582
• Protein Name: Homeobox protein Nkx-2.5
• Gene Name: Nkx2-5
• Organism: Mus musculus (Mouse).
• Sequence Length: 318
• Subcellular Localization: Nucleus .
• Protein Description: Implicated in commitment to and/or differentiation of the myocardial lineage. Acts as a transcriptional activator of ANF in cooperation with GATA4. Binds to the core DNA motif of NPPA promoter. It is transcriptionally controlled by PBX1 and acts as a transcriptional repressor of CDKN2B. Together with PBX1, it is required for spleen development through a mechanism that involves CDKN2B repression..
• Protein Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASCMLAAFKPEAYSGPEAAASGLAELRAEMGPAPSPPKCSPAFPAAPTFYPGAYGDPDPAKDPRADKKELCALQKAVELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELLGPPPPPARRIAVPVLVRDGKPCLGDPAAYAPAYGVGLNAYGYNAYPYPSYGGAACSPGYSCAAYPAAPPAAQPPAASANSNFVNFGVGDLNTVQSPGMPQGNSGVSTLHGIRAW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Sumoylation	SCMLAAFKPEAYSGP HHHHHHHCCHHHCCH	36.90	-
51	Sumoylation	SCMLAAFKPEAYSGP HHHHHHHCCHHHCCH	36.90	-
77	Phosphorylation	AEMGPAPSPPKCSPA HHHCCCCCCCCCCCC	56.81	23737553
163	Phosphorylation	FKQQRYLSAPERDQL HHHHHHCCCCCHHHH	32.61	22817900
182	Acetylation	KLTSTQVKIWFQNRR HHHHHHHHHHHHCCC	25.13	125036201

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
163	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NKX25_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NKX25_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SRF_HUMAN	SRF	genetic	8887666
SRF_HUMAN	SRF	physical	8887666
SMCA4_MOUSE	Smarca4	physical	15525990
TBX1_MOUSE	Tbx1	physical	16556915
MEF2C_MOUSE	Mef2c	physical	19035347
FOXH1_MOUSE	Foxh1	physical	15363409
TBX5_MOUSE	Tbx5	physical	11572777
FBX25_MOUSE	Fbxo25	physical	25725482
UBC_MOUSE	Ubc	physical	25725482

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.