UniProt ID | NKX25_MOUSE | |
---|---|---|
UniProt AC | P42582 | |
Protein Name | Homeobox protein Nkx-2.5 | |
Gene Name | Nkx2-5 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 318 | |
Subcellular Localization | Nucleus . | |
Protein Description | Implicated in commitment to and/or differentiation of the myocardial lineage. Acts as a transcriptional activator of ANF in cooperation with GATA4. Binds to the core DNA motif of NPPA promoter. It is transcriptionally controlled by PBX1 and acts as a transcriptional repressor of CDKN2B. Together with PBX1, it is required for spleen development through a mechanism that involves CDKN2B repression.. | |
Protein Sequence | MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASCMLAAFKPEAYSGPEAAASGLAELRAEMGPAPSPPKCSPAFPAAPTFYPGAYGDPDPAKDPRADKKELCALQKAVELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELLGPPPPPARRIAVPVLVRDGKPCLGDPAAYAPAYGVGLNAYGYNAYPYPSYGGAACSPGYSCAAYPAAPPAAQPPAASANSNFVNFGVGDLNTVQSPGMPQGNSGVSTLHGIRAW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | Sumoylation | SCMLAAFKPEAYSGP HHHHHHHCCHHHCCH | 36.90 | - | |
51 | Sumoylation | SCMLAAFKPEAYSGP HHHHHHHCCHHHCCH | 36.90 | - | |
77 | Phosphorylation | AEMGPAPSPPKCSPA HHHCCCCCCCCCCCC | 56.81 | 23737553 | |
163 | Phosphorylation | FKQQRYLSAPERDQL HHHHHHCCCCCHHHH | 32.61 | 22817900 | |
182 | Acetylation | KLTSTQVKIWFQNRR HHHHHHHHHHHHCCC | 25.13 | 125036201 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
163 | S | Phosphorylation | Kinase | CSNK2A1 | P68400 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NKX25_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NKX25_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SRF_HUMAN | SRF | genetic | 8887666 | |
SRF_HUMAN | SRF | physical | 8887666 | |
SMCA4_MOUSE | Smarca4 | physical | 15525990 | |
TBX1_MOUSE | Tbx1 | physical | 16556915 | |
MEF2C_MOUSE | Mef2c | physical | 19035347 | |
FOXH1_MOUSE | Foxh1 | physical | 15363409 | |
TBX5_MOUSE | Tbx5 | physical | 11572777 | |
FBX25_MOUSE | Fbxo25 | physical | 25725482 | |
UBC_MOUSE | Ubc | physical | 25725482 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...