FBX25_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FBX25_MOUSE
• UniProt AC: Q9D2Y6
• Protein Name: F-box only protein 25
• Gene Name: Fbxo25
• Organism: Mus musculus (Mouse).
• Sequence Length: 357
• Subcellular Localization: Nucleus . In the nucleus, associates with a specific and novel subnuclear dot-like structure. Colocalized with SKP1.
• Protein Description: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. May play a role in accumulation of expanded polyglutamine (polyQ) protein huntingtin (HTT)..
• Protein Sequence: MPFLGQDWRSPGWSWIKTEDGWKRCDPCSHELRSEDSQYTINHSIILNSGEEEIFNNECEYAAKKRKKEHFGNDTAAHSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIRRFTYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHQNPRLIKGLLQDLSSTLGILVRGVGKSVLVGNINIWICRLETVLSWQQQLQNLQVTKQVNTGLTLSDLPLHMLNNILYRFSDGWDIVTLGQVTPTLYMLSEDRRLWKRLCQYHFAEQQFCRHLILSEKGHIEWKLMYFTLQKYYPTKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPEHFIDLFKF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	Phosphorylation	LRSEDSQYTINHSII CCCCCCCEEECEEEE	17.34	28576409
145	Ubiquitination	SLSGVAQKNYFNILD CCCHHHHHHHHHHHH	43.83	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FBX25_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FBX25_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FBX25_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TBX5_MOUSE	Tbx5	physical	25725482

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.