NFIP1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFIP1_MOUSE
• UniProt AC: Q8R0W6
• Protein Name: NEDD4 family-interacting protein 1
• Gene Name: Ndfip1
• Organism: Mus musculus (Mouse).
• Sequence Length: 221
• Subcellular Localization: Endosome membrane ; Multi-pass membrane protein . Golgi apparatus membrane . Cell junction, synapse, synaptosome . Cell projection, dendrite . Secreted . Detected in exosomes and secreted via the exosomal pathway.
• Protein Description: Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cell-mediated inflammation by activating ITCH and thus controlling JUNB degradation. [PubMed: 11748237]
• Protein Sequence: MALALAALAAVEPACGSGYQQLQNEEEPGEPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATIPLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MALALAALA ------CHHHHHHHH	11.09	-
52	Phosphorylation	ITAESAAYFDYKDES CCCCEEEECCCCCCC	9.19	22817900
55	Phosphorylation	ESAAYFDYKDESGFP CEEEECCCCCCCCCC	15.50	22817900
63	Ubiquitination	KDESGFPKPPSYNVA CCCCCCCCCCCCCCC	68.26	27667366
82	Phosphorylation	SYDEAERTKTEATIP CCCHHHHCCCEEEEC	33.55	24719451
83	Ubiquitination	YDEAERTKTEATIPL CCHHHHCCCEEEECC	51.06	20972266
84	Phosphorylation	DEAERTKTEATIPLV CHHHHCCCEEEECCC	30.18	24719451
87	Phosphorylation	ERTKTEATIPLVPGR HHCCCEEEECCCCCC	19.52	24719451
147	Phosphorylation	TTSAAGRYGAISGFG HHCHHHHCCCCCHHH	15.25	25159016
151	Phosphorylation	AGRYGAISGFGLSLI HHHCCCCCHHHHHHH	27.77	25159016
156	Phosphorylation	AISGFGLSLIKWILI CCCHHHHHHHHHHHH	28.55	25159016
204	Ubiquitination	INYAKVRKMPETFSN HHHHHHHCCCHHHCC	62.89	22790023
215	Phosphorylation	TFSNLPRTRVLFIY- HHCCCCCEEEEEEC-	24.16	24759943

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	Nedd4	P46935	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFIP1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFIP1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NEDD4_MOUSE	Nedd4	physical	11748237
NEDD4_HUMAN	NEDD4	physical	11748237
NED4L_HUMAN	NEDD4L	physical	11748237
WWP2_HUMAN	WWP2	physical	11748237
ITCH_HUMAN	ITCH	physical	11748237
NEDD4_MOUSE	Nedd4	physical	22417925
NEDD4_MOUSE	Nedd4	physical	11042109
TS101_MOUSE	Tsg101	physical	23012657
PTEN_MOUSE	Pten	physical	23012657

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.