UniProt ID | NFIP1_MOUSE | |
---|---|---|
UniProt AC | Q8R0W6 | |
Protein Name | NEDD4 family-interacting protein 1 | |
Gene Name | Ndfip1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 221 | |
Subcellular Localization |
Endosome membrane Multi-pass membrane protein . Golgi apparatus membrane . Cell junction, synapse, synaptosome . Cell projection, dendrite . Secreted . Detected in exosomes and secreted via the exosomal pathway. |
|
Protein Description | Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cell-mediated inflammation by activating ITCH and thus controlling JUNB degradation. [PubMed: 11748237] | |
Protein Sequence | MALALAALAAVEPACGSGYQQLQNEEEPGEPEQTAGDAPPPYSSITAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKTEATIPLVPGRDEDFVGRDDFDDTDQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MALALAALA ------CHHHHHHHH | 11.09 | - | |
52 | Phosphorylation | ITAESAAYFDYKDES CCCCEEEECCCCCCC | 9.19 | 22817900 | |
55 | Phosphorylation | ESAAYFDYKDESGFP CEEEECCCCCCCCCC | 15.50 | 22817900 | |
63 | Ubiquitination | KDESGFPKPPSYNVA CCCCCCCCCCCCCCC | 68.26 | 27667366 | |
82 | Phosphorylation | SYDEAERTKTEATIP CCCHHHHCCCEEEEC | 33.55 | 24719451 | |
83 | Ubiquitination | YDEAERTKTEATIPL CCHHHHCCCEEEECC | 51.06 | 20972266 | |
84 | Phosphorylation | DEAERTKTEATIPLV CHHHHCCCEEEECCC | 30.18 | 24719451 | |
87 | Phosphorylation | ERTKTEATIPLVPGR HHCCCEEEECCCCCC | 19.52 | 24719451 | |
147 | Phosphorylation | TTSAAGRYGAISGFG HHCHHHHCCCCCHHH | 15.25 | 25159016 | |
151 | Phosphorylation | AGRYGAISGFGLSLI HHHCCCCCHHHHHHH | 27.77 | 25159016 | |
156 | Phosphorylation | AISGFGLSLIKWILI CCCHHHHHHHHHHHH | 28.55 | 25159016 | |
204 | Ubiquitination | INYAKVRKMPETFSN HHHHHHHCCCHHHCC | 62.89 | 22790023 | |
215 | Phosphorylation | TFSNLPRTRVLFIY- HHCCCCCEEEEEEC- | 24.16 | 24759943 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NFIP1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NFIP1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NEDD4_MOUSE | Nedd4 | physical | 11748237 | |
NEDD4_HUMAN | NEDD4 | physical | 11748237 | |
NED4L_HUMAN | NEDD4L | physical | 11748237 | |
WWP2_HUMAN | WWP2 | physical | 11748237 | |
ITCH_HUMAN | ITCH | physical | 11748237 | |
NEDD4_MOUSE | Nedd4 | physical | 22417925 | |
NEDD4_MOUSE | Nedd4 | physical | 11042109 | |
TS101_MOUSE | Tsg101 | physical | 23012657 | |
PTEN_MOUSE | Pten | physical | 23012657 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...