UniProt ID | MOB4_DROME | |
---|---|---|
UniProt AC | Q7K0E3 | |
Protein Name | MOB kinase activator-like 4 | |
Gene Name | Mob4 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 223 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKMADGSTILRRNRPGTKSKDFCRWPDEPLEEMDSTLAVQQYIQQLIKRDPSNVELILTMPEAQDEGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVTKLGSVCRRVYRIFSHAYFHHRRIFDEFEAETYLCHRFTHFVTKYNLMSKENLIVPINVGENAAPGESEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
147 | Phosphorylation | KYFPSRVSIKESSVT CCCCCCEEECCCHHH | 27.17 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOB4_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOB4_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOB4_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VRET_DROME | vret | physical | 14605208 | |
2AAA_DROME | Pp2A-29B | physical | 20797625 | |
FGOP2_DROME | CG10158 | physical | 20797625 | |
FGOP2_DROME | CG10158 | physical | 24643257 | |
Y0915_DROME | CG10915 | physical | 20797625 | |
HIPPO_DROME | hpo | physical | 20797625 | |
PP2A_DROME | mts | physical | 20797625 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...