MOB4_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MOB4_DROME
• UniProt AC: Q7K0E3
• Protein Name: MOB kinase activator-like 4
• Gene Name: Mob4
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 223
• Protein Sequence: MKMADGSTILRRNRPGTKSKDFCRWPDEPLEEMDSTLAVQQYIQQLIKRDPSNVELILTMPEAQDEGVWKYEHLRQFCMELNGLAVRLQKECSPSTCTQMTATDQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVTKLGSVCRRVYRIFSHAYFHHRRIFDEFEAETYLCHRFTHFVTKYNLMSKENLIVPINVGENAAPGESEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
147	Phosphorylation	KYFPSRVSIKESSVT CCCCCCEEECCCHHH	27.17	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MOB4_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MOB4_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MOB4_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VRET_DROME	vret	physical	14605208
2AAA_DROME	Pp2A-29B	physical	20797625
FGOP2_DROME	CG10158	physical	20797625
FGOP2_DROME	CG10158	physical	24643257
Y0915_DROME	CG10915	physical	20797625
HIPPO_DROME	hpo	physical	20797625
PP2A_DROME	mts	physical	20797625

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.