dbPTM

MFR1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MFR1_SCHPO
UniProt AC	O94423
Protein Name	Meiotic fizzy-related protein 1
Gene Name	mfr1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	421
Subcellular Localization	Nucleus .
Protein Description	Meiosis-specific activator of the anaphase promoting complex/cyclosome (APC/C). Involved in cdc13 degradation..
Protein Sequence	MGDRFIPIRNVSNEFNFSFQSFKECVLSHGSNLRRKTSGTIQRQFMELLSMELFGSQASRSRAFYYGEDKRKIEKKMLDTPDRKSYSLSPISPQSQDMLRQPQKPKRAFPKTPYKILDAPYLKNDFYLNLLDWGQSNVLAVGLASSIYLWSAASGKVVQLHDFGATNHVTSVLWTGKGTQLAVGTDSGVIYIWDIESTKSVRSLKGHSERVAALAWNDNTLTSGGKDEVILHHDLRAPGCCAEMMKVHEQEICGLQWDRSLGQLASGGNDNNLFVWDYRSSRPLHKFEEHTAAVKAIGWSPHQRGILASGGGTIDRCLTIHNTLTGRLQNKLDTGSQVCNMAWSKTSNEIVTTHGFAKNQVSLWKYPSLKNIANLTAHTNRVLYLSMSPDGQSIVTGAGDETLRFWKLFNKKPKEESTLIR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MFR1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MFR1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MFR1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MFR1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
APC4_SCHPO	cut20	physical	11493649
ING2_SCHPO	png2	genetic	19547744
DMA1_SCHPO	dma1	genetic	20826461
SECU_SCHPO	cut2	physical	21389117
CG23_SCHPO	cdc13	physical	21389117

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MFR1_SCHPO

Related Literatures of Post-Translational Modification