MES1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MES1_SCHPO
• UniProt AC: P41005
• Protein Name: Protein mes1
• Gene Name: mes1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 101
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Specifically required for meiosis II (MII). Binds to slp1, an activator of the anapahase promoting complex/cyclcosome (APC/C), and counteracts its function in promoting proteolysis of cdc13. By suppressing the degradation of cdc13 at anaphase I this protein may help maintain a sufficient level of cdc2 kinase activity to complete MII..
• Protein Sequence: MVNTDNKENEPPNMEKAHMDSSNALYRVQRPLQRRPLQELSIELVKPSQTITVKKSKKSTNSSSYFAQLHAASGQNPPPSVHSSHKQPSKARSPNPLLSMR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of MES1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MES1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MES1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MES1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SLP1_SCHPO	slp1	genetic	15791259
SLP1_SCHPO	slp1	physical	15791259
MFR1_SCHPO	mfr1	genetic	21389117
MFR1_SCHPO	mfr1	physical	21389117
SLP1_SCHPO	slp1	physical	21389117
CG23_SCHPO	cdc13	genetic	15791259
CG22_SCHPO	cig2	genetic	15791259
MFR1_SCHPO	mfr1	physical	15791259
MFR1_SCHPO	mfr1	genetic	23628763
CUF2_SCHPO	cuf2	genetic	23628763

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.