| UniProt ID | MEL26_CAEEL | |
|---|---|---|
| UniProt AC | Q94420 | |
| Protein Name | Protein maternal effect lethal 26 | |
| Gene Name | mel-26 | |
| Organism | Caenorhabditis elegans. | |
| Sequence Length | 395 | |
| Subcellular Localization | Cytoplasm, myofibril, sarcomere, M line . Cytoplasm, myofibril, sarcomere, I band . Colocalizes with unc-89 to the M line. | |
| Protein Description | Probable substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. [PubMed: 14528312] | |
| Protein Sequence | MEPRIDGGVFIGGIGNSGNEMCSNGVPALGVSSQTEIKVEKVQHTWTVKNFSHCYQEYLENFVYLQRGDEQLTWSIKIYPKGNGENNKDFVFLCLNRVINNNVKAGKIGFKSQFKLRTAENKDIEMRIHPNPSHSDYVSYIKRDVLFPQIMPRDMIIVNVEIDVAVETITTTNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLTHQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATALLIAADKYRLEELKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTYILARPKNVTGTPGWEDILKGHPNLITDIFSQIDRQSSTGATSSVSNLPGVPMDIPGITGNIVPPPSGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of MEL26_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MEL26_CAEEL !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MEL26_CAEEL !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MEL26_CAEEL !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PAL1_CAEEL | pal-1 | physical | 14704431 | |
| SUMO_CAEEL | smo-1 | physical | 14704431 | |
| MED15_CAEEL | mdt-15 | physical | 14704431 | |
| MEL26_CAEEL | mel-26 | physical | 14704431 | |
| CUL3_CAEEL | cul-3 | physical | 13679921 | |
| CUL3_CAEEL | cul-3 | physical | 22621901 | |
| KTNA1_CAEEL | mei-1 | physical | 22621901 | |
| UNC89_CAEEL | unc-89 | physical | 22621901 | |
| CUL3_CAEEL | cul-3 | physical | 13679922 | |
| NEDD8_CAEEL | ned-8 | physical | 13679922 | |
| MEL26_CAEEL | mel-26 | physical | 13679922 | |
| KTNA1_CAEEL | mei-1 | physical | 13679922 | |
| UNC83_CAEEL | unc-83 | physical | 13679922 | |
| GOP1_CAEEL | gop-1 | physical | 13679922 | |
| YKKA_CAEEL | C02F5.12 | physical | 18692475 | |
| SUMO_CAEEL | smo-1 | physical | 18692475 | |
| PCF11_CAEEL | pcf-11 | physical | 18692475 | |
| KTNA1_CAEEL | mei-1 | physical | 18692475 | |
| MEL26_CAEEL | mel-26 | physical | 18692475 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
