MAL_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MAL_HUMAN
• UniProt AC: P21145
• Protein Name: Myelin and lymphocyte protein
• Gene Name: MAL
• Organism: Homo sapiens (Human).
• Sequence Length: 153
• Subcellular Localization: Membrane; Multi-pass membrane protein.
• Protein Description: Could be an important component in vesicular trafficking cycling between the Golgi complex and the apical plasma membrane. Could be involved in myelin biogenesis and/or myelin function..
• Protein Sequence: MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of MAL_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MAL_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MAL_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MAL_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYD88_HUMAN	MYD88	physical	21988832
UBP7_HUMAN	USP7	physical	21988832
PTPRN_HUMAN	PTPRN	physical	25416956
FBCD1_HUMAN	FIBCD1	physical	25416956
SMIM3_HUMAN	SMIM3	physical	25416956
LSME1_HUMAN	LSMEM1	physical	25416956
LRAD1_HUMAN	LDLRAD1	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.