UniProt ID | LSME1_HUMAN | |
---|---|---|
UniProt AC | Q8N8F7 | |
Protein Name | Leucine-rich single-pass membrane protein 1 | |
Gene Name | LSMEM1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 131 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MTHSSQDTGSCGIQEDGKLYVVDSINDLNKLNLCPAGSQHLFPLEDKIPVLGTNSGNGSRSLFFVGLLIVLIVSLALVFFVIFLIVQTGNKMDDVSRRLTAEGKDIDDLKRINNMIVKRLNQLNQLDSEQN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
20 | Phosphorylation | IQEDGKLYVVDSIND ECCCCEEEEEECCCC | 22673903 | ||
24 | Phosphorylation | GKLYVVDSINDLNKL CEEEEEECCCCCHHC | 22673903 | ||
38 | Phosphorylation | LNLCPAGSQHLFPLE CCCCCCCCCCEEECC | 26437602 | ||
55 (in isoform 2) | Phosphorylation | - | 23909892 | ||
74 | Phosphorylation | LLIVLIVSLALVFFV HHHHHHHHHHHHHHH | 22210691 | ||
96 | Phosphorylation | GNKMDDVSRRLTAEG CCCHHHHHHHHHCCC | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LSME1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LSME1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LSME1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...