UniProt ID | KAT1_HUMAN | |
---|---|---|
UniProt AC | Q16773 | |
Protein Name | Kynurenine--oxoglutarate transaminase 1 | |
Gene Name | KYAT1 {ECO:0000312|HGNC:HGNC:1564} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 422 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Metabolizes the cysteine conjugates of certain halogenated alkenes and alkanes to form reactive metabolites. Catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond.. | |
Protein Sequence | MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Ubiquitination | -----MAKQLQARRL -----CCHHHHHHCC | 50.68 | - | |
15 | Phosphorylation | RRLDGIDYNPWVEFV HCCCCCCCCCHHHHH | 22.62 | - | |
172 | Phosphorylation | MELAGKFTSRTKALV HHHCCCCCCCCEEEE | 22.30 | 20068231 | |
173 | Phosphorylation | ELAGKFTSRTKALVL HHCCCCCCCCEEEEE | 40.88 | 20068231 | |
175 | Phosphorylation | AGKFTSRTKALVLNT CCCCCCCCEEEEECC | 22.04 | 20068231 | |
176 | Ubiquitination | GKFTSRTKALVLNTP CCCCCCCEEEEECCC | 38.32 | - | |
182 | Phosphorylation | TKALVLNTPNNPLGK CEEEEECCCCCCCCC | 24.19 | 20068231 | |
247 | N6-(pyridoxal phosphate)lysine | LTIGSAGKTFSATGW EEEECCCCEEEECCC | 46.22 | - | |
247 | Ubiquitination | LTIGSAGKTFSATGW EEEECCCCEEEECCC | 46.22 | - | |
247 | Other | LTIGSAGKTFSATGW EEEECCCCEEEECCC | 46.22 | 15364907 | |
414 | Ubiquitination | TLQAMDEKLRKWKVE HHHHHHHHHHHHCCC | 49.69 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KAT1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KAT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KAT1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
PCH2_HUMAN | TRIP13 | physical | 25416956 | |
VAC14_HUMAN | VAC14 | physical | 25416956 | |
ZN318_HUMAN | ZNF318 | physical | 28514442 | |
YETS2_HUMAN | YEATS2 | physical | 28514442 | |
ZZZ3_HUMAN | ZZZ3 | physical | 28514442 | |
MBIP1_HUMAN | MBIP | physical | 28514442 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00130 | L-Glutamine |
loading...