JAGN1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: JAGN1_HUMAN
• UniProt AC: Q8N5M9
• Protein Name: Protein jagunal homolog 1 {ECO:0000305}
• Gene Name: JAGN1 {ECO:0000312|HGNC:HGNC:26926}
• Organism: Homo sapiens (Human).
• Sequence Length: 183
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Endoplasmic reticulum transmembrane protein involved in vesicle-mediated transport, which is required for neutrophil function. Required for vesicle-mediated transport; it is however unclear whether it is involved in early secretory pathway or intracellular protein transport. Acts as a regulator of neutrophil function, probably via its role in vesicle-mediated transport: required for defense against fungal pathogens and for granulocyte colony-stimulating factor (GM-CSF) signaling pathway; possibly by regulating glycosylation and/or targeting of proteins contributing to the viability and migration of neutrophils..
• Protein Sequence: MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLSHDQVAMPYQWEYPYLLSILPSLLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQLYRHGKAYRFLFGFSAVSIMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKHK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MASRAGPRAA -----CCCCCCCCCC	22.74	20068231
12	Phosphorylation	AGPRAAGTDGSDFQH CCCCCCCCCCCCCCH	32.24	29255136
15	Phosphorylation	RAAGTDGSDFQHRER CCCCCCCCCCCHHHH	37.75	29255136
35	Phosphorylation	QMSVTLKYEIKKLIY CHHHHHHHHHHHHHH	26.46	22817900
42	Phosphorylation	YEIKKLIYVHLVIWL HHHHHHHHHHHHHHH	7.70	-
91	Phosphorylation	PSLLGLLSFPRNNIS HHHHHHHCCCCCCHH	37.94	24719451
98	Phosphorylation	SFPRNNISYLVLSMI CCCCCCHHHHHHHHH	17.97	22210691
99	Phosphorylation	FPRNNISYLVLSMIS CCCCCHHHHHHHHHH	9.31	22210691
130	Phosphorylation	FPAAQQLYRHGKAYR CHHHHHHHHCCCHHH	9.02	22210691
168	Ubiquitination	WQLYYSKKLLDSWFT HHHHHCHHHHHHHHH	48.63	29967540
172	Phosphorylation	YSKKLLDSWFTSTQE HCHHHHHHHHHHCHH	24.86	23663014
175	Phosphorylation	KLLDSWFTSTQEKKH HHHHHHHHHCHHHHC	25.30	23663014
176	Phosphorylation	LLDSWFTSTQEKKHK HHHHHHHHCHHHHCC	20.72	23663014
177	Phosphorylation	LDSWFTSTQEKKHK- HHHHHHHCHHHHCC-	37.38	23663014
180	2-Hydroxyisobutyrylation	WFTSTQEKKHK---- HHHHCHHHHCC----	50.81	-
180	Ubiquitination	WFTSTQEKKHK---- HHHHCHHHHCC----	50.81	27667366
181	Ubiquitination	FTSTQEKKHK----- HHHCHHHHCC-----	56.74	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of JAGN1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of JAGN1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of JAGN1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
CR3L1_HUMAN	CREB3L1	physical	25416956
KASH5_HUMAN	CCDC155	physical	25416956
OST48_HUMAN	DDOST	physical	26344197
S61A1_HUMAN	SEC61A1	physical	26344197
VDAC2_HUMAN	VDAC2	physical	26344197
VDAC3_HUMAN	VDAC3	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 616022: Neutropenia, severe congenital 6, autosomal recessive (SCN6)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.