UniProt ID | ITBP2_HUMAN | |
---|---|---|
UniProt AC | Q9UKP3 | |
Protein Name | Integrin beta-1-binding protein 2 | |
Gene Name | ITGB1BP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 347 | |
Subcellular Localization | ||
Protein Description | May play a role during maturation and/or organization of muscles cells.. | |
Protein Sequence | MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSLLCRNKG ------CCCCCCCCC | 30.01 | - | |
96 | Phosphorylation | PLNVIPKSAETLRRE CCCCCCCCHHHHHHH | 26.44 | 26437602 | |
99 | Phosphorylation | VIPKSAETLRRERPK CCCCCHHHHHHHCCC | 25.86 | 26437602 | |
141 | Phosphorylation | EPGAGLDSLIRTGSS CCCCCHHHHHHCCCC | 30.64 | 24719451 | |
291 | Phosphorylation | MPSRVEISLVKADPG CCCEEEEEEEECCCC | 17.38 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ITBP2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ITBP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ITBP2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RARA_HUMAN | RARA | physical | 25036637 | |
RARB_HUMAN | RARB | physical | 25036637 | |
XPO5_HUMAN | XPO5 | physical | 25036637 | |
RARG_HUMAN | RARG | physical | 25036637 | |
PP1R7_HUMAN | PPP1R7 | physical | 25036637 | |
SRP14_HUMAN | SRP14 | physical | 25036637 | |
PLOD2_HUMAN | PLOD2 | physical | 25036637 | |
PDD2L_HUMAN | PDCD2L | physical | 25036637 | |
PI51A_HUMAN | PIP5K1A | physical | 25036637 | |
MO4L2_HUMAN | MORF4L2 | physical | 25036637 | |
PDD2L_HUMAN | PDCD2L | physical | 26186194 | |
PDD2L_HUMAN | PDCD2L | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...