| UniProt ID | ITBP2_HUMAN | |
|---|---|---|
| UniProt AC | Q9UKP3 | |
| Protein Name | Integrin beta-1-binding protein 2 | |
| Gene Name | ITGB1BP2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 347 | |
| Subcellular Localization | ||
| Protein Description | May play a role during maturation and/or organization of muscles cells.. | |
| Protein Sequence | MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSLLCRNKG ------CCCCCCCCC | 30.01 | - | |
| 96 | Phosphorylation | PLNVIPKSAETLRRE CCCCCCCCHHHHHHH | 26.44 | 26437602 | |
| 99 | Phosphorylation | VIPKSAETLRRERPK CCCCCHHHHHHHCCC | 25.86 | 26437602 | |
| 141 | Phosphorylation | EPGAGLDSLIRTGSS CCCCCHHHHHHCCCC | 30.64 | 24719451 | |
| 291 | Phosphorylation | MPSRVEISLVKADPG CCCEEEEEEEECCCC | 17.38 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ITBP2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ITBP2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ITBP2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RARA_HUMAN | RARA | physical | 25036637 | |
| RARB_HUMAN | RARB | physical | 25036637 | |
| XPO5_HUMAN | XPO5 | physical | 25036637 | |
| RARG_HUMAN | RARG | physical | 25036637 | |
| PP1R7_HUMAN | PPP1R7 | physical | 25036637 | |
| SRP14_HUMAN | SRP14 | physical | 25036637 | |
| PLOD2_HUMAN | PLOD2 | physical | 25036637 | |
| PDD2L_HUMAN | PDCD2L | physical | 25036637 | |
| PI51A_HUMAN | PIP5K1A | physical | 25036637 | |
| MO4L2_HUMAN | MORF4L2 | physical | 25036637 | |
| PDD2L_HUMAN | PDCD2L | physical | 26186194 | |
| PDD2L_HUMAN | PDCD2L | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
