| UniProt ID | IRGM_HUMAN | |
|---|---|---|
| UniProt AC | A1A4Y4 | |
| Protein Name | Immunity-related GTPase family M protein | |
| Gene Name | IRGM | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 181 | |
| Subcellular Localization | Golgi apparatus membrane. Cell membrane. Cytoplasmic vesicle, phagosome membrane. Cytoplasmic vesicle, autophagosome membrane. Cell projection, phagocytic cup. Behaves like an integral membrane protein. Recruited to the plasma membrane around forming | |
| Protein Description | Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility (By similarity).. | |
| Protein Sequence | MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | AMNVEKASADGNLPE CCCHHHHHCCCCHHH | 37.65 | - | |
| 47 | Phosphorylation | GDSGNGMSTFISALR CCCCCHHHHHHHHHH | 22.89 | 23612710 | |
| 48 | Phosphorylation | DSGNGMSTFISALRN CCCCHHHHHHHHHHH | 18.98 | 23612710 | |
| 51 | Phosphorylation | NGMSTFISALRNTGH CHHHHHHHHHHHCCC | 19.63 | 23612710 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IRGM_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IRGM_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IRGM_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ULK1_HUMAN | ULK1 | physical | 25891078 | |
| AMRA1_HUMAN | AMBRA1 | physical | 25891078 | |
| BECN1_HUMAN | BECN1 | physical | 25891078 | |
| BAKOR_HUMAN | ATG14 | physical | 25891078 | |
| A16L1_HUMAN | ATG16L1 | physical | 25891078 | |
| NOD2_HUMAN | NOD2 | physical | 25891078 | |
| IRGM_HUMAN | IRGM | physical | 25891078 | |
| NOD1_HUMAN | NOD1 | physical | 25891078 | |
| TLR3_HUMAN | TLR3 | physical | 25891078 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
