IRF4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IRF4_MOUSE
• UniProt AC: Q64287
• Protein Name: Interferon regulatory factor 4
• Gene Name: Irf4
• Organism: Mus musculus (Mouse).
• Sequence Length: 450
• Subcellular Localization: Nucleus.
• Protein Description: Transcriptional activator. Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter. Binds the immunoglobulin lambda light chain enhancer, together with PU.1. Probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF4 and activation of genes..
• Protein Sequence: MNLETGSRGSEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSVFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLDDTQMAMGHPYPMTAPYGSLPAQQVHNYMMPPHDRSWRDYAPDQSHPEIPYQCPVTFGPRGHHWQGPSCENGCQVTGTFYACAPPESQAPGIPIEPSIRSAEALALSDCRLHICLYYRDILVKELTTTSPEGCRISHGHTYDVSNLDQVLFPYPDDNGQRKNIEKLLSHLERGLVLWMAPDGLYAKRLCQSRIYWDGPLALCSDRPNKLERDQTCKLFDTQQFLSELQVFAHHGRPAPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNTGHFLRGYELPEHVTTPDYHRSLRHSSIQE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MNLETGSRGSEF ---CCCCCCCCCCCC	43.56	28576409
186	Phosphorylation	RDYAPDQSHPEIPYQ HHCCCCCCCCCCCCC	48.68	25266776
349	Sumoylation	LCSDRPNKLERDQTC ECCCCCCCCCCCCCC	55.17	-
435	Phosphorylation	YELPEHVTTPDYHRS CCCCCCCCCHHHHHH	34.22	25266776
436	Phosphorylation	ELPEHVTTPDYHRSL CCCCCCCCHHHHHHH	17.05	25266776
446	Phosphorylation	YHRSLRHSSIQE--- HHHHHCHHHCCC---	23.78	25266776
447	Phosphorylation	HRSLRHSSIQE---- HHHHCHHHCCC----	23.36	25266776

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
446	S	Phosphorylation	Kinase	ROCK2	O75116	PSP
446	S	Phosphorylation	Kinase	ROCK2	P70336	Uniprot
447	S	Phosphorylation	Kinase	ROCK2	O75116	PSP
447	S	Phosphorylation	Kinase	ROCK2	P70336	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IRF4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IRF4_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TLX3_MOUSE	Tlx3	physical	20211142
IRF8_MOUSE	Irf8	physical	10590072
STAT3_MOUSE	Stat3	physical	20064451
RIPK2_MOUSE	Ripk2	physical	24670424
MYD88_MOUSE	Myd88	physical	24670424
TRAF6_MOUSE	Traf6	physical	24670424

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphorylation of IRF4 by ROCK2 regulates IL-17 and IL-21 productionand the development of autoimmunity in mice.";
Biswas P.S., Gupta S., Chang E., Song L., Stirzaker R.A., Liao J.K.,Bhagat G., Pernis A.B.;
J. Clin. Invest. 120:3280-3295(2010).
Cited for: PHOSPHORYLATION AT SER-446 AND SER-447.
PubMed: 20697158