IRF8_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IRF8_MOUSE
• UniProt AC: P23611
• Protein Name: Interferon regulatory factor 8
• Gene Name: Irf8
• Organism: Mus musculus (Mouse).
• Sequence Length: 424
• Subcellular Localization: Nucleus . Cytoplasm . In resting macrophages, localizes in the cytoplasm. Translocated in the nucleus upon IFN-gamma induction.
• Protein Description: Plays a role as a transcriptional activator or repressor (By similarity). Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a negative regulatory role in cells of the immune system. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes. [PubMed: 22992524]
• Protein Sequence: MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYMGMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAYDTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQPGLPKLYGPDGLEPVCFPTADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTNQFIRELQQFYATQSRLPDSRVVLCFGEEFPDTVPLRSKLILVQVEQLYARQLVEEAGKSCGAGSLMPALEEPQPDQAFRMFPDICTSHQRPFFRENQQITV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
107	Phosphorylation	QLDISEPYKVYRIVP HCCCCCCCEEEEECC	14.72	17200120
151	Phosphorylation	EELIKEPSVDEYMGM HHHHHCCCHHHHCCC	43.20	24704852
162	Phosphorylation	YMGMTKRSPSPPEAC HCCCCCCCCCCCHHH	31.14	25159016
164	Phosphorylation	GMTKRSPSPPEACRS CCCCCCCCCCHHHHH	55.09	22942356
211	Phosphorylation	QMVISFYYGGKLVGQ HHHHHHHCCCEECCE	19.86	22817900
280	Phosphorylation	ERGVLLHSNRKGVFV HHCEEEECCCCEEEE	38.00	24704852
310	Sumoylation	VCKGRPNKLERDEVV EECCCCCCCCCCCEE	55.17	-
333	Phosphorylation	IRELQQFYATQSRLP HHHHHHHHHHHHCCC	12.37	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	Cbl	P22682	PMID:22199232
-	K	Ubiquitination	E3 ubiquitin ligase	Trim21	Q62191	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IRF8_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IRF8_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC9_MOUSE	Ube2i	physical	18955028
SUMO1_MOUSE	Sumo1	physical	18955028
IRF4_MOUSE	Irf4	physical	10590072
ZBT17_MOUSE	Zbtb17	physical	18045875

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.