| UniProt ID | IL23A_HUMAN | |
|---|---|---|
| UniProt AC | Q9NPF7 | |
| Protein Name | Interleukin-23 subunit alpha | |
| Gene Name | IL23A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 189 | |
| Subcellular Localization | Secreted . Secreted upon association with IL12B. | |
| Protein Description | Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.. | |
| Protein Sequence | MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of IL23A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL23A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL23A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL23A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IL23R_HUMAN | IL23R | physical | 12023369 | |
| I12R1_HUMAN | IL12RB1 | physical | 12023369 | |
| IL12B_HUMAN | IL12B | physical | 11114383 | |
| HERP1_HUMAN | HERPUD1 | physical | 20054003 | |
| IFFO1_HUMAN | IFFO1 | physical | 26186194 | |
| RNF41_HUMAN | RNF41 | physical | 26186194 | |
| RNF41_HUMAN | RNF41 | physical | 28514442 | |
| IFFO1_HUMAN | IFFO1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
