I36RA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: I36RA_HUMAN
• UniProt AC: Q9UBH0
• Protein Name: Interleukin-36 receptor antagonist protein
• Gene Name: IL36RN
• Organism: Homo sapiens (Human).
• Sequence Length: 155
• Subcellular Localization: Secreted.
• Protein Description: Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR..
• Protein Sequence: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MVLSGALCFRM ----CCCCCEEEEEE	15.60	30576142
77	Phosphorylation	CGVGQEPTLTLEPVN CCCCCCCEEEEECCC	31.46	-
89	Phosphorylation	PVNIMELYLGAKESK CCCEEEEEECCCCCC	6.98	-
108	Phosphorylation	YRRDMGLTSSFESAA EECCCCCCCCCCCCC	19.32	26434776
109	Phosphorylation	RRDMGLTSSFESAAY ECCCCCCCCCCCCCC	37.76	26434776
110	Phosphorylation	RDMGLTSSFESAAYP CCCCCCCCCCCCCCC	28.00	26434776
113	Phosphorylation	GLTSSFESAAYPGWF CCCCCCCCCCCCCEE	19.05	26434776
116	Phosphorylation	SSFESAAYPGWFLCT CCCCCCCCCCEEEEE	11.29	26434776

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of I36RA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of I36RA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of I36RA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SSBP4_HUMAN	SSBP4	physical	16189514
RRAS_HUMAN	RRAS	physical	28514442
SRC_HUMAN	SRC	physical	28514442
UBB_HUMAN	UBB	physical	28514442
SRSF8_HUMAN	SRSF8	physical	28514442
HNRLL_HUMAN	HNRNPLL	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.