UniProt ID | HES4_HUMAN | |
---|---|---|
UniProt AC | Q9HCC6 | |
Protein Name | Transcription factor HES-4 | |
Gene Name | HES4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 221 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3' (By similarity).. | |
Protein Sequence | MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Acetylation | MAADTPGKPSASPMA CCCCCCCCCCCCCCC | 36.68 | 19818751 | |
12 | Phosphorylation | TPGKPSASPMAGAPA CCCCCCCCCCCCCCC | 21.39 | - | |
20 | Phosphorylation | PMAGAPASASRTPDK CCCCCCCCCCCCCCC | 26.22 | - | |
22 | Phosphorylation | AGAPASASRTPDKPR CCCCCCCCCCCCCCC | 33.90 | - | |
69 | Phosphorylation | LDALRKESSRHSKLE HHHHHHHHHHCHHHH | 35.39 | 23879269 | |
70 | Phosphorylation | DALRKESSRHSKLEK HHHHHHHHHCHHHHH | 34.79 | 23879269 | |
97 | Phosphorylation | SLRRVQVTAALSADP HCCCEEHHEHHCCCH | 6.79 | - | |
101 | Phosphorylation | VQVTAALSADPAVLG EEHHEHHCCCHHHHH | 26.37 | - | |
103 | Ubiquitination | VTAALSADPAVLGKY HHEHHCCCHHHHHHH | 28.45 | - | |
135 | Ubiquitination | CEGVPADVRSRLLGH CCCCCHHHHHHHHHH | 6.95 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HES4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HES4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HES4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PHS2_HUMAN | PCBD2 | physical | 20211142 | |
LTN1_HUMAN | LTN1 | physical | 20195357 | |
RGS3_HUMAN | RGS3 | physical | 20195357 | |
COPG2_HUMAN | COPG2 | physical | 20195357 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...