| UniProt ID | HES4_HUMAN | |
|---|---|---|
| UniProt AC | Q9HCC6 | |
| Protein Name | Transcription factor HES-4 | |
| Gene Name | HES4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 221 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3' (By similarity).. | |
| Protein Sequence | MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Acetylation | MAADTPGKPSASPMA CCCCCCCCCCCCCCC | 36.68 | 19818751 | |
| 12 | Phosphorylation | TPGKPSASPMAGAPA CCCCCCCCCCCCCCC | 21.39 | - | |
| 20 | Phosphorylation | PMAGAPASASRTPDK CCCCCCCCCCCCCCC | 26.22 | - | |
| 22 | Phosphorylation | AGAPASASRTPDKPR CCCCCCCCCCCCCCC | 33.90 | - | |
| 69 | Phosphorylation | LDALRKESSRHSKLE HHHHHHHHHHCHHHH | 35.39 | 23879269 | |
| 70 | Phosphorylation | DALRKESSRHSKLEK HHHHHHHHHCHHHHH | 34.79 | 23879269 | |
| 97 | Phosphorylation | SLRRVQVTAALSADP HCCCEEHHEHHCCCH | 6.79 | - | |
| 101 | Phosphorylation | VQVTAALSADPAVLG EEHHEHHCCCHHHHH | 26.37 | - | |
| 103 | Ubiquitination | VTAALSADPAVLGKY HHEHHCCCHHHHHHH | 28.45 | - | |
| 135 | Ubiquitination | CEGVPADVRSRLLGH CCCCCHHHHHHHHHH | 6.95 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HES4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HES4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HES4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PHS2_HUMAN | PCBD2 | physical | 20211142 | |
| LTN1_HUMAN | LTN1 | physical | 20195357 | |
| RGS3_HUMAN | RGS3 | physical | 20195357 | |
| COPG2_HUMAN | COPG2 | physical | 20195357 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
